Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "hacer"

1. A mi esposa le encanta hacer manualidades como pasatiempo.

2. Algunos fines de semana voy al campo a hacer senderismo, mi pasatiempo favorito.

3. ¿Qué te gusta hacer?

4. Claro, puedes hacer todas las preguntas que quieras.

5. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

6. Después de hacer ejercicio, me gusta darme una ducha caliente.

7. Después de hacer la compra en el supermercado, fui a casa.

8. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

9. En otoño, es el momento perfecto para cosechar las aceitunas y hacer aceite de oliva.

10. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

11. Es un cultivo versátil que se puede utilizar para hacer alimento para humanos y animales, y también se utiliza en la producción de biocombustibles

12. Gracias por hacer posible este maravilloso momento.

13. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

14. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

15. Las hojas de la hierbabuena se pueden usar para hacer té o mojitos.

16. Las hojas de palma se usan a menudo para hacer sombreros y cestas.

17. Las hojas de papel se pueden reciclar para hacer papel nuevo.

18. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

19. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

20. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

21. Las redes sociales también son un medio para hacer negocios y promocionar productos.

22. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

23. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

24. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

25. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

26. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

27. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

28. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

29. No dejes para mañana lo que puedas hacer hoy.

30. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

31. Para aliviar un resfriado, puedes hacer una infusión de hierbas como el eucalipto y la manzanilla.

32. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

33. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

34. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

35. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

36. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

Random Sentences

1. The awards ceremony honored individuals for their charitable contributions to society.

2. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

3. Hindi pa rin matukoy ng mga pulis kung sino ang salarin sa pamamaril sa opisina.

4. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

5. Nakakalungkot isipin na hindi na ako makakapakinig ng bagong awitin mula sa Bukas Palad dahil sa pagkawala ni Fr. Manoling.

6. Les ingénieurs appliquent la science pour créer des produits et des systèmes.

7. Tinatawag niya ang anak ngunit walang sumasagot.

8. Ang sigaw ng matandang babae.

9. Det er vigtigt at have relevant erfaring, når man søger en ny jobposition.

10. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

11. Ang siko ng bata at tumama sa kanyang kaliwang dibdib.

12. Ang malawak na kagubatan ay isang magandang halimbawa ng isang ekosistema na mayabong.

13. They go to the gym every evening.

14. La música puede ser utilizada para fines políticos o sociales.

15. Size 6 ang sukat ng paa ni Elena.

16. Hindi ko alam kung saan ito mag-uumpisa, pero may gusto ako sa iyo.

17. Les personnes âgées peuvent faire face à la fin de leur vie avec courage et dignité.

18. Umiling siya at umakbay sa akin.

19. Mas maganda pa ring magpatawad kaysa magtanim ng inis sa puso.

20. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

21. Nakita ko sa facebook ang dati kong kaklase.

22. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

23. Scissors can be sharpened using a sharpening stone or taken to a professional for sharpening.

24.

25. Makapangyarihan ang salita.

26. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

27. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

28. Nationalism is a political ideology that emphasizes the importance of the nation-state.

29. Gumawa ako ng cake para kay Kit.

30. Mahalaga na magpakatotoo ka sa mga taong bukas palad sa iyo upang mas maintindihan ka nila ng husto.

31. Investing refers to the process of allocating resources with the expectation of generating a profit.

32. Después de hacer la compra en el supermercado, fui a casa.

33. Nakakasama sila sa pagsasaya.

34. Los alimentos ricos en antioxidantes, como las bayas y los vegetales de hoja verde, pueden ayudar a prevenir enfermedades crónicas.

35. Tila may pagdududa siya sa katapatan ng kanyang kaibigan.

36. Kain na tayo. yaya ni Maico sa amin.

37. Hindi sadyang nagkaubusan ng pagkain sa aking ref.

38. The company's financial statement showed an increase in acquired assets.

39. Ang daming palamuti ang nakalagay sa kanyang cake.

40. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

41. We have been waiting for the train for an hour.

42. Kailangan nating mag-ingat sa kalusugan upang maiwasan ang mga sakit, samakatuwid.

43. Sa tapat ng tarangkahan, may malalaking bulaklak na de-korasyon.

44. Nandoon lamang pala si Maria sa library.

45. Nasa akin pa rin ang huling halakhak.

46. Naaksidente ang aming plano sa bakasyon dahil sa pagbaha sa lugar na aming pupuntahan.

47. Saan pupunta si Larry sa Linggo?

48. Sa pamamagitan ng kundiman, naipapahayag ang mga hindi nasasabi ngunit nararamdaman ng mga pusong sugatan.

49. Sinakop ng mga espanyol ang Pilipinas nang mahigit sa 300 years.

50. Mas matangkad ako kaysa sa kanya.

Recent Searches

hacerforevernaritolulusogngipinhinawakangagambanandiyannanayspareunosanmatatagrecentlybaduyhayopjackykabarkadaasknandoonnilolokotumalimhardinlagunabiromaglarokungexcitedmaagapancommunicationnaminschoolkasangkapanegenagadmagka-apoknowledgebotongnovellessinimulanbinabaratnakakatakotsigninventedconclusion,ngumitipagtayoexcuseiphonewalngbangmuntingmaninipispopularizenapabayaanownmakapanglamang10thdalawaguiltyumiiyakgananglayuantangeksyeheyrosariolovemaibahawakanalysepaghihirapdinadaananmoodonlyhitiktumutuboappregularmentenangmaliliitkanilasequehorsenagkitanasiraellakikitaaksidentetumugtogteamaayusinamincakeipinamilimakahingikikokayongkasaysayandatingiyonkanya-kanyangnagbabalamaninirahannakapaglarosalubongputilegitimate,bahanatulogkonsultasyonkamponaglalaronatitiyaknanonoodenergiumupokonsiyertomedyonatapostonmayroongmatuloggoodmandukotamazonpanunuksomalayalalimalitaptapmagkaparehoadaptabilityubodclubinterestzamboangamagka-babynakaluhodkarwahengpagkapasoknakatirasakristantumunogmakidaloinaminjuegosnabuhayisasamaobviouskindergartenjeepneypinoymaliitinventionpulisanihinprutassweetaniyabasahantuladbehinddinalaumarawdebatesguideyeahmarsosparkmakakawawatahimikpagkagisingmesangnaiwansectionshotdoginlovepromotenanlalamigsyangmerchandisemagbagonakatuklawrightsitemstamadsinundangpagka-diwatabangoskandoyyatagiyeraestadosdisplacementmahiwagahiningapusodetectedeksenaantoniohinanap