Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "hacer"

1. A mi esposa le encanta hacer manualidades como pasatiempo.

2. Algunos fines de semana voy al campo a hacer senderismo, mi pasatiempo favorito.

3. ¿Qué te gusta hacer?

4. Claro, puedes hacer todas las preguntas que quieras.

5. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

6. Después de hacer ejercicio, me gusta darme una ducha caliente.

7. Después de hacer la compra en el supermercado, fui a casa.

8. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

9. En otoño, es el momento perfecto para cosechar las aceitunas y hacer aceite de oliva.

10. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

11. Es un cultivo versátil que se puede utilizar para hacer alimento para humanos y animales, y también se utiliza en la producción de biocombustibles

12. Gracias por hacer posible este maravilloso momento.

13. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

14. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

15. Las hojas de la hierbabuena se pueden usar para hacer té o mojitos.

16. Las hojas de palma se usan a menudo para hacer sombreros y cestas.

17. Las hojas de papel se pueden reciclar para hacer papel nuevo.

18. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

19. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

20. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

21. Las redes sociales también son un medio para hacer negocios y promocionar productos.

22. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

23. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

24. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

25. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

26. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

27. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

28. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

29. No dejes para mañana lo que puedas hacer hoy.

30. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

31. Para aliviar un resfriado, puedes hacer una infusión de hierbas como el eucalipto y la manzanilla.

32. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

33. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

34. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

35. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

36. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

Random Sentences

1. The Getty Center and the Los Angeles County Museum of Art (LACMA) are renowned art institutions in the city.

2. The acquired assets included a portfolio of real estate properties.

3. El estudio científico produjo resultados importantes para la medicina.

4. Smoking-related illnesses can have a significant impact on families and caregivers, who may also experience financial and emotional stress.

5. Cut to the chase

6. Laganap ang paggamit ng social media sa kabataan ngayon.

7. Durante las vacaciones, nos reunimos alrededor de la mesa para compartir historias y risas con la familia.

8. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

9. El nacimiento es un evento muy emocionante y significativo en la vida de una familia.

10. Maaaring magdulot ng sakit sa kalooban ang mga dental problem, kaya't mahalagang agapan ito upang maiwasan ang mas malalang kalagayan.

11. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

12. La novela de Gabriel García Márquez es un ejemplo sublime del realismo mágico.

13. La tos es un mecanismo de defensa del cuerpo para expulsar sustancias extrañas de los pulmones.

14. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

15. Sang ayon si Jose sa suhestiyon ng kanyang kaibigan.

16. Halos gawin na siyang prinsesa ng mga ito.

17. Puwede bang pahiram ng konting oras mo para mag-usap tayo?

18. The festival showcases a variety of performers, from musicians to dancers.

19. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

20. Hang in there."

21. Elektronikken i et hjem kan hjælpe med at forbedre komfort og livskvalitet.

22. He could not see which way to go

23. Marahil anila ay ito si Ranay.

24. Parang nahulaan ng kanyang ina ang kanyang iniisip.

25. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

26. Gusto ko hong magpapalit ng dolyar.

27. Malayo ang tabing-dagat sa bahay namin.

28. Anong wala! pasinghal na sabi ni Aling Marta

29. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

30. Las suturas se utilizan para cerrar heridas grandes o profundas.

31. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

32. The victim was able to identify the culprit who had been harassing them for months.

33. La alimentación equilibrada y una buena hidratación pueden favorecer la cicatrización de las heridas.

34. Matapos mahuli, nanumpa siya ng katapatan sa Estados Unidos.

35. They volunteer at the community center.

36. It was founded by Jeff Bezos in 1994.

37. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

38. Nakakatakot maglakad mag-isa sa hatinggabi sa isang hindi kilalang lugar.

39. Siguro matutuwa na kayo niyan.

40. He is driving to work.

41. Nilinis ng janitor ang silid-aralan bago mag-umpisa ang klase.

42. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

43. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

44. The United States has a system of federalism, where power is divided between the national government and the individual states

45. Las plantas proporcionan oxígeno y son esenciales para mantener el equilibrio ecológico.

46. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

47. Natawa ang bata ngunit pumayag din ito.

48. Sí, claro que puedo ayudarte con eso.

49. Huh? umiling ako, hindi ah.

50. Keluarga sering kali memberikan hadiah atau uang sebagai bentuk ucapan selamat kepada ibu dan bayi yang baru lahir.

Recent Searches

priestevilhacerhapasinleohusayspecializednariningsasakyanpagkaingbigshouldgraduallydumaramijeromemabilisobservererpangangatawanmababawkabosesrodonakaparehacontrolleddamdaminsaanconsumekara-karakahangaringsinusuklalyanpagapangmovieiiklipangungutyamagalangpaglulutomasungitsinisirabilerpagtangobalotparusahannilolokouniversalcuandodaratingbutikimarieplantasamerikatrabahonasasakupan1960spakikipagbabagpinagpatuloymerlindatelecomunicacioneslinggongmagsalitadyipipagbilitagumpaymadungisinangbabenakahugbirdssaritapinagmamasdansiksikaninternalmaalwangtinapayrenombresingernayonokaypakibigaydumagundongtinanggallondonleadingleytesumasakaymatalinokadalasnapakatagalconvey,sementongugatbahagyangpeksmanrhythmbagamaattractivenagbibirogumagamitexpeditedbarreraslaganapcongratsbiocombustiblestig-bebentelargeneed,heartbeatpagkakapagsalitafriesumaganganibersaryomournedpancitinfluenceandoyhinahaplostwitchmapuputieditornagpaiyakkahirapandiagnosesmaingatpakealampotentialdadalomatapobrengpaanoeeeehhhhfeelingminerviemakauwiatensyonhmmmhmmmmrosasandokmagkasinggandadidtwolimosrepresentedgagamitmagsabipagdidilimdagligeipinaalamumanosaan-saanhirambasahanworrybiggestnapakalusogconbinabalikjosemagpa-checkuppasinghaltableadditionallylupainthirdsinagotginisingdesisyonantinderabagamatnagdalatsonggoemailsolidifyandroidpromisetypesnag-umpisaperwisyocourtpangkaraniwanpagkagisingkasaysayanmakikiraannanigasmarchpagkagalitumibigguidemainstreamkahilingandisyembreutusannapuyatmulti-billionnauntogmadamotnagsimulareservationsinceparusakakaibangyakaphagdanan