Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "hacer"

1. A mi esposa le encanta hacer manualidades como pasatiempo.

2. Algunos fines de semana voy al campo a hacer senderismo, mi pasatiempo favorito.

3. ¿Qué te gusta hacer?

4. Claro, puedes hacer todas las preguntas que quieras.

5. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

6. Después de hacer ejercicio, me gusta darme una ducha caliente.

7. Después de hacer la compra en el supermercado, fui a casa.

8. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

9. En otoño, es el momento perfecto para cosechar las aceitunas y hacer aceite de oliva.

10. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

11. Es un cultivo versátil que se puede utilizar para hacer alimento para humanos y animales, y también se utiliza en la producción de biocombustibles

12. Gracias por hacer posible este maravilloso momento.

13. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

14. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

15. Las hojas de la hierbabuena se pueden usar para hacer té o mojitos.

16. Las hojas de palma se usan a menudo para hacer sombreros y cestas.

17. Las hojas de papel se pueden reciclar para hacer papel nuevo.

18. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

19. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

20. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

21. Las redes sociales también son un medio para hacer negocios y promocionar productos.

22. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

23. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

24. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

25. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

26. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

27. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

28. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

29. No dejes para mañana lo que puedas hacer hoy.

30. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

31. Para aliviar un resfriado, puedes hacer una infusión de hierbas como el eucalipto y la manzanilla.

32. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

33. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

34. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

35. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

36. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

Random Sentences

1. The music playlist features a variety of genres, from pop to rock.

2. Bago magsimula ang kasal, nagdaos sila ng tradisyunal na ritwal upang basbasan ang mag-asawa.

3. Les écoles offrent des programmes d'apprentissage des langues pour les étudiants.

4. Hindi maganda na maging sobrang mapanghinala sa lahat ng tao dahil sa agam-agam.

5. Ang lolo at lola ko ay patay na.

6. Binati niya ito ng "Magandang umaga sa iyo".

7. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

8. Maaari bang hawakan ang iyong mga kamay.

9. Hindi ka talaga maganda.

10. Nakahain na ako nang dumating siya sa hapag.

11. Jacky! Pare! nakangiti niyang sabi habang papalapit kami.

12. Hawak ang tirador ay sinaliksik ni Kiko ang buong paligid.

13. Dahil sa maling pagdisiplina, naglipana ang mga pangit na gawi sa lipunan.

14. Siyang pagdating ni Roque na agad ding tumalon sa ilog upang iligtas ang mga anak.

15. Ang haba na nang bigote mo, mag ahit ka nga!

16. Isang beses naman ay ang sandok ang hinahanap.

17. Ibinigay ni Ana ang susi sa kanya.

18. Mas maganda ang photoshoot sa dapit-hapon dahil ang ilaw ay nakakapagbigay ng ibang vibe.

19. Ang mga akda ni Rizal tulad ng "Noli Me Tangere" at "El Filibusterismo" ay naglalaman ng mga kritisismo sa pamamahala ng Espanya at nag-udyok sa rebolusyonaryong diwa sa Pilipinas.

20. Naglaba ang kalalakihan.

21. Mayroon ba kayong reaksiyon, Senador Ferrer?

22. La paciencia es la clave para conseguir lo que deseamos.

23. She burned bridges with her friends by spreading gossip about them.

24. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

25. Hindi dapat basta-basta magpautang ng pera dahil ito ay maaaring magdulot ng problema sa kahuli-hulihan.

26. Pinigilan nya ang mga kamay ko, Wag!

27. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

28. Paboritong laro ng kuya ko ang basketbol.

29. Ikinagagalak ng pamahalaan na maghatid ng tulong sa mga nangangailangan.

30. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

31. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

32. Dumadating ang mga guests ng gabi.

33. Saan nakatira si Ginoong Oue?

34. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

35. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

36. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

37. Ano ang nasa tapat ng ospital?

38. Scissors are commonly used for cutting paper, fabric, and other materials.

39. Mange transkønnede personer oplever at blive udsat for chikane, mobning og vold på grund af deres kønsidentitet.

40. Masanay na lang po kayo sa kanya.

41. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

42. There are a lot of reasons why I love living in this city.

43. Ang pagpapa-tanggal ng ngipin ay ginagawa kapag hindi na maaring malunasan ang sira nito.

44. Binansagang "Gymnastics Prodigy" si Carlos Yulo dahil sa kanyang talento at husay.

45. Aray! nagcurve ball sya sa sakit sa sahig.

46. Mi esposo me llevó a cenar en un restaurante elegante para el Día de los Enamorados.

47. Sa dakong huli ko lang narealize na mali ang ginawa ko.

48. Omelettes are a popular choice for those following a low-carb or high-protein diet.

49. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

50. Las hojas del libro están todas marcadas con notas adhesivas.

Recent Searches

hacerinausenightbooksunconstitutionalinspiredpaglalabamabihisansalu-salosalamangkeroika-12bagkusoftetumatawaundeniablepagtilapaperniyangvehiclesharapnakakapagtakaemocionesmakingmalawaknogensindeklasesinunodkasayawsimbahantuladhumakbangtelefonerpinatutunayannagkasakitpasadyanatinnagsusulatjosefanapabalikwasbalanganak-pawistandangpollutionjuliusmuntikanairconmaka-yopagkaimpaktomasaganangcoinbasepangulosugalma-buhaynabasanakabilimawalabagyongkawawangmagbungaenfermedades,cebustorymakapagpigilspreadpublicationthroughreviewerskagayaparaisofireworksplatformnapapansintmicasonsanayangnakakaakitpinagkaloobannangahaspagpapakainnakakaanimpalabaskartongkainaninalagaanginagawanapakagagandasapilitangklimagusting-gustodawtindahalamanmaya-mayadapit-haponhulikwebangunfortunatelynapapalibutanbuhawiilogpaskoloanspakikipagtagponag-aagawanburolmasakits-sorrymagta-taximagulangnasaalas-diyesonepalibhasanagwagigandanagbibigaykubyertosnagsidalopamilyanakatingingmamayapaglapastangankagatolprintmidtermcardigandasalkasalkasalukuyangpostcarddurantesumuwayilangrawnakapagngangalitfigurasipapahingapoliticshelpdemocraticnapagtantomangahasmayamangcombineddrogabayaniintyainasalfacultycardterm1977pagkakataonmayamanmgaisinakripisyolalabhanasiaticturismobipolarvarietyngumiwibiyayangasahanexperienceswakasipalinislazadajunekinaumagahantengainformationnaglakadkumarimotbroadcastingsandalicantidadmedievalbathalanakabaonkulturskillsbuhayngayonmahabangngusoknownamanoursarilingunti-untiservicessupilinhistorynakakunot-noongbulaklakattention