Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "multo"

1. Nagkwento ang lolo tungkol sa multo.

2. Natakot umano ang mga estudyante nang marinig ang kwento tungkol sa multo sa eskwelahan.

Random Sentences

1. Tatlong araw bago dumating ang ikatlong Sabado, sorpresa ko siyang dinalaw.

2. Musk has been married three times and has six children.

3. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

4. Oo naman 'My! Walang hihigit pa sa Beauty ko noh.

5. As your bright and tiny spark

6. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

7. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

8. Nous allons visiter le Louvre demain.

9. Pakibigay na lang sa punong-guro ang liham ng mga magulang mo.

10. La música es una parte importante de la cultura española y se celebra en numerosos festivales y eventos a lo largo del año

11. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

12. Eine hohe Inflation kann das Wirtschaftswachstum verlangsamen oder stoppen.

13. She does not skip her exercise routine.

14. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

15. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

16. Wag mo nga akong lokohin. Sige na.

17. Nagulat si Mang Kandoy sapagkat ang kulay ng dugo ng tigre ay abo.

18. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

19. Narinig ko ang hinagpis ng mga magsasaka dahil sa mababang presyo ng kanilang ani.

20. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

21. Nasa Pilipinas na si Raymond ngayon.

22. Ikinuwento niya ang nangyari kay Aling Pising.

23. Hendes skønhed er betagende. (Her beauty is mesmerizing.)

24. The invention of the telephone led to the creation of the first radio dramas and comedies

25. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

26. Después de la cena, nos sentamos a conversar en el jardín.

27. Paano kayo makakakain nito ngayon?

28. Akin na cellphone mo. paguutos nya.

29. Transkønnede personer har forskellige oplevelser af deres kønsidentitet og kan have forskellige præferencer og behov.

30. Ang pagsisindi ng kandila tuwing gabi ay naging isang ritwal na nagbibigay ng katahimikan sa kanyang isip.

31. Jeg er helt forelsket i hende. (I'm completely in love with her.)

32. Balak kong magluto ng kare-kare.

33. The bird sings a beautiful melody.

34. Sa bundok ng mga anito na ngayon ay kilala bilang bundok ng Caraballo itinindig ang krus.

35. La physique est une branche importante de la science.

36. Oo. Tatawagan ka daw niya pag nandyan na siya.

37. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

38. There are a lot of benefits to exercising regularly.

39. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

40. El agua es un tema de importancia mundial y está relacionado con el desarrollo sostenible y la seguridad alimentaria.

41. Mula sa kinatatalungkuang giray na batalan, saglit siyang napatigil sa paghuhugas ng mumo sa kamay.

42. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

43. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

44. Hanggang ngayon, si Hidilyn Diaz ay patuloy na nagsasanay at sumusuporta sa mga atletang nangangarap tulad niya.

45. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

46. Det har ændret måden, vi interagerer med hinanden og øget vores evne til at dele og få adgang til information

47. Maliit ang telebisyon ng ate ko.

48. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

49. ¡Hola! ¿Cómo estás?

50. Ang pang-aabuso sa droga ay nagdudulot ng malalang problema sa kalusugan ng mga tao.

Recent Searches

computeresimplengmultostudiedbitawanplannaiinggittominternetgamotpaulaeskwelahandagat-dagatannabahalamaalikabokinfinityshininghenrynaglutofeedbackmalasutlaownkawaljingjingmednyangsakimgayunmannamnamumulotbarrocofianapakatongiwinasiwaseksamenbrancher,nagstagepinag-aralanatinpara-paranggrowthkaysarapmagpaliwanagmarmaingtanyagpaakyatbarongtransparentkuwartabinabatibulatemarahasnatapostabanag-iisangarbularyoduguanhubad-baronasulyapangaslumahokmatalimnabigkascurtainsmakausapmaongdunmaskimarahilhariamparohumansignificantclimbednagsilabasanlargerglobalnamanrosastime,usaintroduceferrersumpunginpagsayadvirksomhedernananaginippinakamatabangnagpapasasakinikitakomunikasyonpagtutolpropensomakikitanaglahowalkie-talkienamumulaklaknagkakatipun-tiponlasonguugud-ugodpangyayarinagpabayadnagliwanagpamahalaanculturalnagsisigawkagipitanmagalangbeautyairportpinagbigyanhitabayawakelevatorkumalaspakakasalanpersonastennisgospelamericakarapatangdepartmentnagwalismagbabalanatitiyaklagnattig-bebeintenapilimagazinesmaskinerlalargaparusahanpigilanguerrerojeepneytandangbintanafriendkapagbinabarathanapinnaglabanagpasanfollowingmatutulognobodynakabaonlabinsiyamipatuloylagaslasasahanmoneylakadpalayocommercialmayabongnabiglaobservation,maidbisikletakaragatandiaper2001misteryotawapaggawaisuboplagasejecutankahusayanpinalayasenerobooksmaayosnariyansocialehverganangoutlineutilizarjenakaugnayankulangmatabangbinanggamaestromahirapcivilizationdalawanoopaghingihitiktrensinumangeasierpetsanaritopage