Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

26 sentences found for "physical"

1. A wife can be a source of emotional and physical intimacy for her husband.

2. Ailments are physical or mental health conditions that cause discomfort or illness.

3. Ailments can be managed through self-care practices, such as meditation or physical therapy.

4. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

5. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

6. Balancing calorie intake and physical activity is important for maintaining a healthy weight.

7. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

8. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

9. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

10. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

11. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

12. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

13. Cancer survivors can face physical and emotional challenges during and after treatment, such as fatigue, anxiety, and depression.

14. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

15. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

16. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

17. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

18. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

19. Limitations can be physical, mental, emotional, financial, or social.

20. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

21. Regular exercise and playtime are important for a dog's physical and mental well-being.

22. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

23. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

24. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

25. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

26. This could be physical products that you source and ship yourself, or digital products like e-books or courses

Random Sentences

1. Ang kalayaan ay hindi dapat magdulot ng pang-aabuso sa kapwa.

2. Cosecha el maíz cuando las espigas estén completamente maduras

3. Sa dapit-hapon, masarap mag-picnic kasama ang pamilya at kaibigan.

4. I admire the perseverance of those who overcome adversity.

5. Ikinagagalak kong makilala ka sa personal pagkatapos ng maraming taon ng pagkakaibigan online.

6. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

7. Nagsmile siya sa akin at ipinikit niya ulit yung mata niya.

8. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

9. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkaligaw sa landas ng katwiran.

10. Einmal ist keinmal.

11. Napakaganda ng loob ng kweba.

12. Nagsisilbi siya bilang volunteer upang magbigay ng tulong sa mga nangangailangan.

13. The culprit who stole the purse was caught on camera and identified by the victim.

14. Nagalit ang diwata sa ginawa ng madamot na matanda.

15. Puwede ba akong sumakay ng dyipni?

16. Kebahagiaan adalah hasil dari kepuasan, keseimbangan, dan rasa bersyukur atas apa yang kita miliki.

17. The website has a lot of useful information for people interested in learning about history.

18. Sino pa, isisingit ni Ogor, di si Dikyam!

19. It is important to be patient and persistent, and to not get discouraged if you encounter obstacles along the way

20. Hindi na niya narinig iyon.

21. Marahil ay malamig ang klima sa bundok sa panahon ngayon.

22. Apa yang bisa saya bantu? - How can I help you?

23. Ano ang ilalagay ko sa kusina?

24. The bride looked stunning in her wedding dress, truly a beautiful lady.

25. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

26. Hindi na niya makuhang laruin ang beyblade bagamat ayaw niya itong bitiwan sa loob ng kaniyang kamay o di kaya'y bulsa.

27. Players move the ball by kicking it and passing it to teammates.

28. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

29. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

30. Users can like, react, or share posts on Facebook to show their engagement and support.

31. I'm going through a lot of stress at work, but I'm just trying to hang in there.

32. Ibinigay ni Ana ang susi kay Sally.

33. The feeling of frustration can lead to stress and negative emotions.

34. Tila hindi niya iniinda ang sakit kahit halatang nasasaktan siya.

35. He was busy with work and therefore couldn't join us for dinner.

36. Have you tried the new coffee shop?

37. Sweetness can be a source of comfort and pleasure for many people.

38. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

39. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

40. Meron ho ba kayong mainit na kalamansi juice?

41. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

42. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

43. Sumasakit na naman ang aking ngipin.

44. Kailan niya kailangan ang kuwarto?

45. He is not taking a walk in the park today.

46. Sa panahon ng tag-ulan, naglipana ang mga lamok sa amin.

47. Kailangan magpakatotoo at humingi ng tulong kung hindi makakabayad ng utang sa tamang panahon.

48. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

49. The dog barks at the mailman.

50. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

Recent Searches

mamiphysicalsamurichknowspetsaipinikiteeeehhhhburdenbroadhitredilansumalasatisfactionworrybranchescondotayojunjunrangemethodsprocessstringpasinghaledit:requireamazonabanganbooksnakatitiyakerhvervslivetkatawangmarurumiestasyonpaglakimagtatakamaawaingliligawanprogramamabutibyejuanworkingprogrammingmaibigankaugnayanpag-uugalieditfulfillmentlalapitpagkalungkotelectroniciniwanimikomeletteipagpalitsomethingfuncioneskannunomaglalakadgirlkumaripasrosematulunginpulisninanaisyumabangpaghangalumamangtumahanhulumagkasamakinasisindakanhanginhubad-baropobrengnakakapamasyalpangungutyamakakatakasmusicianpagkamanghakahaponpaumanhineskuwelaluluwasgulattatlumpungactingpagkasabitumatanglawphilanthropykasiyahanmagpapagupitcountrypagtangisatensyongcancerpumilitaxinakilalagawinpakinabangannaglarokamandagtumambadbinitiwan1970snakaakyatipinauutangginawangnavigationmahabolseryosongmusicalpinisilunconstitutionalumiwassakenincitamenterlumiitkabighalaranganmaonglangkaydespuesguidancenatulakindependentlycalidadbinigyanmahiyaanaynamakombinationnenapublicitypinalayasnagisingkuwebatinitindapinanoodnapadaanagostomatalimengkantadamaaksidenteagilaendvidereahhhhcommunityteleviewingtakesnagdaramdamfuefeltsparesaidbulongjennybasketballfrescoparkematulispasensyanuhtoyaksidentefredreadingenergiplatformsdigitalparatingeksaytedtrueklasrumpunsoitimpriestnagtaasmangingisdamalayangnapatinginnaiinisyongmaslaruinsurgerypassworddinggincountriesmalagodyanmurangdesdeparacountless