Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "pneumonia"

1. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

2. He was hospitalized for pneumonia and was on a ventilator for several days.

3. Pneumonia can be caused by bacteria, viruses, or fungi.

4. Pneumonia can be life-threatening if not treated promptly.

5. Pneumonia can be prevented with vaccines and by maintaining good hygiene.

6. Pneumonia is a serious infection that affects the lungs.

7. She had a weakened immune system and was more susceptible to pneumonia.

8. She missed several days of work due to pneumonia and needed to rest at home.

9. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

10. The chest x-ray showed signs of pneumonia in the left lung.

11. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

12. The cough syrup helped to alleviate the symptoms of pneumonia.

13. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

14. The doctor prescribed antibiotics to treat the pneumonia.

15. The elderly are at a higher risk of developing pneumonia.

16. The hospital had a special isolation ward for patients with pneumonia.

17. The patient had a history of pneumonia and needed to be monitored closely.

18. The patient was discharged from the hospital after recovering from pneumonia.

19. The pneumonia vaccine is recommended for those over the age of 65.

20. The symptoms of pneumonia include cough, fever, and shortness of breath.

Random Sentences

1. Madulas ang magnanakaw, ngunit nahuli rin siya ng mga naglalakad na sibilyan.

2. Hitik na hitik sa bunga ang nasabing puno.

3. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

4. Alors que certaines personnes peuvent gagner de l'argent en jouant, c'est un investissement risqué et ne peut pas être considéré comme une source de revenu fiable.

5. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

6. She watched a series of documentaries about the history of ancient civilizations.

7. Napuno ng mga tao ang mga lansangan, kaya't ang lungsod ay hitik sa kasiyahan sa selebrasyon ng pista.

8. Oy saan ka pupunta?! sigaw nya.

9. Tumingala siya ngunit siya'y nasilaw.

10. Wolverine has retractable adamantium claws and a regenerative healing factor.

11. All these years, I have been surrounded by people who believe in me.

12. Patunayan mo na hindi ka magiging perwisyo sa kanila.

13. We admire the creativity of innovative thinkers and inventors.

14. Good morning, Beauty! aniya sabay halik sa mga labi ko.

15. The number of stars in the universe is truly immeasurable.

16. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

17. El cultivo de hortalizas es fundamental para una alimentación saludable.

18. Dapat magkaroon ng patas na pagtrato sa lahat ng sektor ng lipunan, kabilang ang anak-pawis.

19. Napakaganda ng mga pasyalan sa bansang Japan.

20. La labradora de mi amigo es muy valiente y no le teme a nada.

21. Eine gute Gewissensentscheidung kann uns helfen, unser Leben in eine positive Richtung zu lenken.

22. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

23. Magpapabakuna ako bukas.

24. Aplica abono orgánico al suelo para proporcionar nutrientes adicionales a las plantas

25. I know I should have apologized sooner, but better late than never, right?

26. Isang araw, kararating pa lang ng mag-asawa mula sa pagtitinda ng gulay, galing sa kuwarto ay lumabas si Aya at hiningi ang ipinagbiling prutas.

27. Magtatapos ako ng aking thesis sa buwan na ito, datapwat kailangan kong maglaan ng mas maraming oras para dito.

28. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

29. Ang mga puno ng kape ay nagbibigay ng mabangong amoy sa buong paligid.

30. No podemos negar la realidad, debemos aceptarla y adaptarnos a ella.

31. Walang ka kwenta-kwenta ang palabas sa telebisyon.

32. Ang mga palaisipan ay hindi lamang nagbibigay ng hamon sa ating kaisipan, kundi nagbibigay rin ng mga oportunidad para sa pagpapalawak ng kaalaman.

33. Not only did he crash my car, but he also tried to blame me for it. That just added insult to injury.

34. Ito lang naman ang mga nakalagay sa listahan:

35. Claro, puedes hacer todas las preguntas que quieras.

36. Totoo nga! Sa ilalim niyon nakabaon ang gong na susi ng kanilang kasaganaan.

37. Pinikit niya ang mata upang namnamin ang sarap ng tsokolate.

38. Mabait siya at nanggagamot siya nang libre.

39. Mathematics helps develop critical thinking and problem-solving skills.

40. Huwag ka nanag magbibilad.

41. Ang mag-aaral ay nagsusulat ng mga sanaysay at mga ulat bilang bahagi ng kanilang mga proyekto.

42. Saan niya pinapagulong ang kamias?

43. Kanino makikipaglaro si Marilou?

44. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

45. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

46. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

47. Pinaghihiwa ko ang mga kamatis.

48. The company's financial statement showed an increase in acquired assets.

49. Nasa Cebu si Trina sa Disyempre?

50. Diyos ko, ano po itong nangyayari sa aming anak?

Recent Searches

halinglingumupobihiraumulanpneumoniamauntogexperience,laamangopportunitynapanatutuwamatangumpayganyannag-isipkailanrestawranprobinsyasandalinglayuanmusiciansjennytelevisionnag-iisakasalanannanaymangingibigituturositawinvitationgardenkargangipinasyangtignancapacidadriyanltobiliblinawdisyembresuccessreachtsetaashiningisigamorenainterestspriestkablanlapitanreplacedelvisbeganrosainiwancalciumeffektivmalagospecialmisusedplacemedievalhigitbriefbangdollyconventionalhandonenatingalacallergodalingspecializedbalecontrolabroadtalestudieddedicationmasterhelpfulcomunesideaculturalmaglalabing-animkalakihanlumiwagmamipagkasabitatanghaliinproducererdulasarongenergibinge-watchingwhatevertoybalingfeedbackmagpa-pictureklimadatamangyarilabingpedengmag-alasaga-agapaaralanlabinsiyamitongguhitsinabitabing-dagatnanghahapdimakingmensajesiwinasiwaspwedengbisikletayoutubelutoentreplagasteleviewingthirdsynchealthierreserbasyonnapakatagalnagkitakomunikasyonlumipatnakaririmarimkarununganumiiyakkinauupuanhinawakanpagkapasoknagbiyayapagkakalutopagsalakayartistaskatuwaannagmadalingnapanoodmananakawinvesthampaslupahiwapagtataasdadalawininasikasomakabilitutungobarung-barongmakabawilalakadpresidentelumakidiwatatinaytinahakawang-awapaparusahannatuwainagawmiyerkuleshanapbuhayvaccinesmaintindihanmangahasnapatigilpinangalanangawaingmismopapayasalaminnglalabaipinauutangcultivationpakakasalanrodonahinatidmusicalfreedomsginahiramnaantiglalargapawisasukalcaracterizacandidatesnilayuanmandirigmangmartiancommercialnakakapuntalalim