Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "friend"

1. "Dog is man's best friend."

2. Dogs are often referred to as "man's best friend".

3. Happy birthday to my best friend, I hope you have a wonderful day!

4. He admires his friend's musical talent and creativity.

5. He is having a conversation with his friend.

6. He is not having a conversation with his friend now.

7. I accidentally let the cat out of the bag about my friend's crush on someone in our group.

8. I am writing a letter to my friend.

9. I baked a delicious chocolate cake for my friend's birthday.

10. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

11. I have been taking care of my sick friend for a week.

12. I sent my friend a bouquet of flowers and a card that said "happy birthday."

13. I woke up to a text message with birthday wishes from my best friend.

14. My best friend and I share the same birthday.

15. My friend was better off not knowing about her boyfriend's infidelity - ignorance is bliss, or so they say.

16. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

17. The value of a true friend is immeasurable.

18. To: Beast Yung friend kong si Mica.

Random Sentences

1. His presidency was marked by controversy and a polarizing political climate.

2. Talagang dito ho sa palengke'y maraming naglipanang batang gaya niyan

3. Juan siempre espera el verano para cosechar frutas del huerto de su abuela.

4. La boda de mi amigo fue una celebración inolvidable.

5. Gusto ko sanang bumili ng bahay.

6. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

7. Maraming aklat ang naisulat tungkol kay Apolinario Mabini at ang kanyang kontribusyon sa kasaysayan ng Pilipinas.

8. Mi esposo y yo hemos estado juntos por muchos Días de San Valentín, pero siempre encontramos una manera de hacerlo especial.

9. Limitations can be a result of geographic location or access to resources and opportunities.

10. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

11. Ang mga pasahero ay nagbigay ng kanilang mga mungkahi upang mapabuti ang karanasan sa paglalakbay.

12. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

13. Sehari di negeri sendiri lebih baik daripada seribu hari di negeri orang.

14. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

15. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

16. Cosecha el maíz cuando las espigas estén completamente maduras

17. Napag desisyonan ko na. Love is sacrifice, right?

18. Ang sigaw ng matandang babae.

19. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

20. Bagaimana cara memasak nasi yang enak? (What is the recipe for cooking delicious rice?)

21. Hinde ka namin maintindihan.

22. Ang paglilinis at pag-aayos ng bahay ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

23. Sa hirap ng buhay, ang aking kabiyak ay ang aking kakampi at kasama sa pagtahak ng mga hamon.

24. Dahil sa kakulangan ng kalinisan, naglipana ang mga daga sa tindahan.

25. Ang digmaan ay maaaring magdulot ng mga trauma at sakit sa mga biktima at kalahok.

26. He applied for a credit card to build his credit history.

27. Pano ba yan.. wala ng magkakagusto sa akin kasi mahina ako..

28. Siya ay laging nagmamalabis sa pag-aaksaya ng pera para sa mga luho.

29. Binabasa niya ng pahapyaw ng kabuuan ng seleksyon at nilalaktawan ang hindi kawili-wili

30. Bakit lumilipad ang manananggal?

31. La música española es rica en historia y diversidad, con una variedad de géneros y estilos

32. Nagluto ng pansit ang nanay niya.

33. Sumigaw ng malakas si Perla "Paro! Paro!", marami ang nakarinig at tinulungan siya ngunit walang Amparo silang nakita.

34. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

35. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

36. La realidad es que nunca sabemos lo que nos depara el futuro.

37. The teacher assigned a hefty amount of homework over the weekend.

38. Mabuti pa sila, nakikita ang masayang paligid.

39. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

40. Hiram na libro ang ginamit ko para sa aking research paper.

41. Television has also had an impact on education

42. Saya suka musik. - I like music.

43. Los árboles pueden perder sus hojas en invierno, creando un aspecto desnudo y frío.

44. Natayo ang bahay noong 1980.

45. Marami sa atin ang may mga pangarap sa buhay na nais nating tuparin.

46. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

47. Nanlilimahid ang mga bata sa daan.

48. Ang pagtulong sa iba ay isang halimbawa ng kabutihang-loob na pinagsisikapan ng marami na isabuhay araw-araw.

49. Ang kalayaan ay nagbibigay sa atin ng kakayahang magpasya at magplano para sa ating sariling kinabukasan.

50. Tinamaan ng lumilipad na bola ang bintana at ito’y nabasag.

Similar Words

girlfriendboyfriendbestfriendfriends

Recent Searches

friendpulongsalbaheexperience,raciallabahinmonumentolinalayawreynamissiondiseasepinagathenasupilinkumaripaschooseconsumedisposalmalihislegacynahigasandoksentencemamamanhikanpinaladkalakingsaanhigpitanmansanasthereforebaldetaposaddressfamebuwanfists1876gracesnobtakesgayundindireksyonpangyayaricompartennatitirasumunodrefersproporcionarheybehaviorfourunancuandorawtabasquatterpanalanginmulingmaputicontrolledclientepagkaraanbutolandslidestorypedeclientsartistacourtnapakahabaogornatitiyakkriskaspeedsamanabasapigilanmaarawaberjeepneytendernoonginiligtaspagbabagong-anyomakitangdespitearguetigaspagpalitsauditatlongnalasingindependentlynasasakupansparkdreamslipatpaki-ulitguitarrakwartokuwadernokanikanilangevenoutlineihahatidnakatagokamakailanpagdudugogeologi,kinakitaanoktubreeskwelahankayang-kayangmakakawawanapatawagnakaka-inmahahawabaranggaykapintasangkumakalansingkasaganaanusuariomakakakainhanggangkaaya-ayangnahuhumalingnanahimiknagbakasyonkarwahengnagwo-workintensidadyouthtahimikpaghuhugaspagkaangatactualidadsirasaan-saancosechar,malalakinagwikangnatanongpesokampanatog,tuyotinikmannagbagovidtstraktrewardingalas-dosemocionessuzettegubattinulunganiligtasgownswimmingsorpresapangakobayaningnapakaantesutilizanibabawpalayokstreetsellingestatedisenyongbutigjortisamarepublicannatulogganunnyanumakyatmagdaannakinigcashnuhiigibcarriedgalinglenguajewinstasapangalanpananglawinangtambayanrisebutchnogensindeknightbilimalayaspelling