Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "here"

1. Congrats Beast! Proud girlfriend here! natatawang sabi ko.

2. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

3. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

4. I forgot your birthday, but here's a card anyway. Better late than never, right?

5. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

6. Sayang, jangan khawatir, aku selalu di sini untukmu. (Don't worry, dear, I'm always here for you.)

7. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Ano ang pinapakinggan mo sa radyo?

3. Mahilig siya sa pagluluto, datapwat madalas ay hindi niya nasusunod ang tamang recipe.

4. The politician made a series of speeches, outlining her plans for improving healthcare.

5. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

6. Nanood sina Pedro ng sine kahapon.

7. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

8. La seguridad en línea es importante para proteger la información personal y financiera.

9. Los héroes son modelos a seguir para las generaciones futuras.

10. Ang sugal ay maaaring magdulot ng pagkawala ng pag-aasenso at pagkakataon sa buhay.

11. Hun er en fascinerende dame. (She is a fascinating lady.)

12. Sapagkat baon sa hirap ang lahat, napipilitan silang maging sunud-sunuran sa napakatakaw na mangangalakal.

13. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

14. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

15. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

16. Agad niyang dinala ito kay Mang Sanas.

17. Sino ang kasama ng ate mong naglakad kahapon?

18. Helte kan være en kilde til håb og optimisme i en verden, der kan være svær.

19. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

20. Magtaka ka na kung hindi pa sya umuuwi bukas.

21. Masyadong mahal ang pagkain sa hotel.

22. Mathematics is the study of numbers, quantities, and shapes.

23. Pinagsulat si Jayson ng pangungusap sa pisara.

24. Sa Chinese New Year, ang mga tao ay nagbabasbasan at nagpapalakas ng kanilang mga panalangin para sa magandang kapalaran.

25. Hinugot niya ang susi sa kanyang bulsa at binuksan ang pinto.

26. She is playing with her pet dog.

27. At tage ansvar for vores handlinger og beslutninger er en del af at have en god samvittighed.

28. Erfaring har lært mig at tage ansvar og være proaktiv.

29. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

30. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

31. Sadyang masarap ang lutong ng tinapay na ito.

32. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

33. Ang mga mangingisda ay nagtatanim ng mga alon sa kanilang pagmamahal sa karagatan.

34. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

35. Good things come to those who wait.

36. The charitable donation made it possible to build a new library in the village.

37. La música es una parte importante de la educación musical y artística.

38. Gusto ko ng mas malaki pa rito.

39. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

40. Simula nung gabing iyon ay bumalik na ang sigla ni Nicolas at nagsimula na siyang manilbihan sa Panginoon

41. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

42. Si Maria ay nagpasya nang lumayo mula sa kanyang asawa dahil sa patuloy na pisikal na abuso.

43. Sa hirap ng sitwasyon, nangahas siyang humingi ng tulong mula sa mga estranghero.

44. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

45. Ang India ay napakalaking bansa.

46. Hindi ko ho kayo sinasadya.

47. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

48. El concierto de la orquesta sinfónica fue una experiencia sublime para los asistentes.

49. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

50. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

Similar Words

thereWhereThereforeanywhere

Recent Searches

magisingvislaryngitisforcesherebehindlalabasnilolokoumakbaynatayomagalingnababakasgaanokababaihanpagsalakayownprutaspulitikointindihinltobopolsinihandapulapabalangshareapologeticitinuringhariitinulosnatingalamarmaingtomorrowtumindigmaniladettetaingaminamasdantamasawsawanconditioningkungcreatedmanghikayatkonsultasyonanak-pawisnaminalituntuninchineseblogspeecheskapaglibongitinatagnatitiyakendviderematulunginnagpapaypaymabaitpagkasabiteleponoonline,nakapagreklamopangyayarihuertoilogturonhawlamakalaglag-pantymarketingmahawaannatitiranakakapagpatibayroquerolenakaakyatmasaholtawanaliligoninyongdistansyangitipinaulanantagtuyotandoycomepasensyanakatingingpunong-kahoybabacomunicarsegagmuloperahankaparehanapipilitansoundmakapilingshiftsarilingbitiwankakayananemphasizedemailnaiinggithowevermakawalareportergayunpamanmaaribagyodarkdiversidadpeople'sdiyansyanapabayaanbutilbaliwtransmitidassumalakaymalapalasyophilippinenakalagaymagtiwalamagkakaanakinastatopicyatafonossuriinpagkaawapangitpamilyakainitanramdamlaruanomelettekarnabaltrentamakikipagbabagomgelitegraceaalishaloscryptocurrencybaryolunastechnologicalprogrammingquicklymagigitinghistoriawidelymagpakaramimamipanunuksonakagawiandilawcashmarasiganusapinatirabestfriendhumalosalitangnaiisipmagagawaedukasyoninilistakasalukuyannakahigangaktibistasasambulatninaaliscandidatespodcasts,heidondelumiwanagbinitiwansummitboksingpansamantalamadalingjagiyaquekabutihantinaasansigekaboseso-onlinesenatepakisabisakimkinalilibingannandiyannagliliwanagsumisid