Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "before"

1. A couple of minutes were left before the deadline to submit the report.

2. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

3. Before a performance, actors often say "break a leg" to each other for good luck.

4. Before television, most advertising was done through print media, such as newspapers and magazines

5. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

6. Commuters are advised to check the traffic update before leaving their homes.

7. Don't count your chickens before they hatch

8. Have they visited Paris before?

9. Have we seen this movie before?

10. He likes to read books before bed.

11. He was warned not to burn bridges with his current company before accepting a new job offer.

12. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

13. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

14. I am absolutely certain that I locked the door before leaving.

15. I don't think we've met before. May I know your name?

16. I have seen that movie before.

17. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

18. It's wise to compare different credit card options before choosing one.

19. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

20. Jeg har aldrig følt mig så forelsket før. (I've never felt so in love before.)

21. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

22. My grandfather used to tell me to "break a leg" before every soccer game I played.

23. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

24. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

25. They were originally established in 1947 as the Minneapolis Lakers before relocating to Los Angeles in 1960.

26. We have a lot of work to do before the deadline.

27. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

Random Sentences

1. Kumaripas ng takbo ang batang may dalang bola nang makita ang kanyang nanay.

2. They do yoga in the park.

3. Limitations can be frustrating and may cause feelings of disappointment and failure.

4. Agad na kumalat ang balita na may dala si Ana na pagkain, kaya sumugod sila sa bahay ni Aling Rosa.

5. Ice for sale.

6. Nasa Massachusetts ang Stoneham.

7. Det er vigtigt at huske, at helte også er mennesker med fejl og mangler.

8. Iskedyul ni Tess, isang estudyante

9. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

10. A couple of weeks ago, I went on a trip to Europe.

11. Umikot ka sa Quezon Memorial Circle.

12. Dahil sa magandang kwento, hindi ko namalayang nahuhumaling na pala ako sa pagbabasa ng nobela.

13. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

14. Después de la entrevista de trabajo, recibí la oferta de empleo.

15. Muchas personas pobres no tienen acceso a servicios básicos como la educación y la atención médica.

16. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

17. Magkasamang tutungo sa lugar na walang sakit, walang gutom, walang hirap.

18. Palibhasa ay madalas na masigasig sa pagtuklas ng mga bagong kaalaman at ideya.

19. Les enseignants sont responsables de la gestion de classe pour garantir un environnement propice à l'apprentissage.

20. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

21. The scientific community is constantly seeking to expand our understanding of the universe.

22. Les personnes âgées peuvent avoir besoin de soins médicaux réguliers pour maintenir leur santé.

23. Selamat ulang tahun! - Happy birthday!

24. Nagpapasalamat ako sa aking mga magulang dahil sa kanilang bukas palad na pagtanggap sa akin kahit anong desisyon ko sa buhay.

25. Tumakbo siya para sa pagka-pangulo noong 1935 ngunit natalo kay Manuel Quezon.

26. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

27. Sa tuwing nagkakasama kami, nadarama ko ang walang hanggang pagmamahal ng aking kabiyak.

28. En Argentina, el Día de San Valentín se celebra en el mes de julio.

29. Bakit wala ka bang bestfriend?

30. Kung maramot ka sa pagbigay ng tulong, huwag magtaka kung walang tutulong sa'yo.

31. Libre si Clara sa Sabado ng hapon.

32. Air susu dibalas air tuba.

33. Lumalakad siya ngayon na walang-tiyak na patutunguhan.

34. Bigyan mo naman siya ng pagkain.

35. Doon nila ipinasyang mag honeymoon.

36. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

37. Det er vigtigt at kende sine grænser og søge hjælp, hvis man oplever problemer med gambling.

38. Pinabulaanang muli ito ni Paniki.

39. Emphasis is an important tool in public speaking and effective communication.

40. Påskedag fejrer Jesu opstandelse fra de døde og markerer afslutningen på Holy Week.

41. Ang sampaguita ang pambansang bulaklak ng Pilipinas.

42. Paboritong laro ng kuya ko ang basketbol.

43. Drømme kan være en kilde til kreativitet og innovation.

44. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

45. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

46. Las pinturas abstractas pueden ser interpretadas de diferentes maneras por el espectador.

47. Narinig ko ang lagaslas ng tubig mula sa shower.

48. En España, el cultivo de la vid es muy importante para la producción de vino.

49. Gusto ni Itay ang maaliwalas na umaga habang umiinom ng kape.

50. Nakasama umano sa listahan ng mga apektado ang ilang barangay sa lungsod.

Recent Searches

beforereadingitlogventaconditioningmaipagmamalakingtinulunganmananakawmatulunginkatuwaankasaganaanna-suwaynapakalungkotctricasasukaldireksyonnapatigilmakikituloglalakadhalamanbumagsakrubberbipolarbutterflypaulit-ulitarawhuertokunwababaemagkaibareguleringaganapangitianitohumanonaglaonsobrangzoodiscoveredbiropusangpinag-usapanipantaloptignanlasingkauntingbumibiliaumentarquicklykatedralmangahasnapanoodpinilingleukemiabituinhiwaconnectingcurrentlimospaanojunjunmabihisanmagsayangbastaeitherdevelopmenthumanosformatmakikiligomagagamitcultivateddinadasalnagbakasyonmeaningcinediwatasasayawinnagawamagkakaanakpakanta-kantangpagkapunonagsisigawnagpatimplapinagkiskisfysik,ngipingsiyudadnasabikuwadernobridealaysteerkarapatangiverhvordansyanandoonmangungudngoddennezoomtiyamakapasadinmagpahabanagkitaidea:mahinangsellthoughtsmayakapclassmate1980dalawangboholtemperaturanag-aalanganeksempelnag-isipnapatingalasparknapatawagdiningdalagahugispanighanapinjolibeeitinuromangyaribecomeniyondesigningmasipagsinipangcorrectingnag-iisipmagdoorbellnamataynaapektuhanmalumbaypakibigyantikettemparaturainvestpacienciamanatilipamasaheangalpagkuwanartistfremstillesumasakitkinalilibinganpagbigyanmilyongconventionalangelainterestmakipag-barkadapasigawtinutopkongresobagongkanginadoktorbaonnakauslingnakainmabangisentry:gumagalaw-galawarghpaslitninakalawakanwebsiteimpitnapadpadnamungaimpactedlittlehalamanangkadalagahangbanlagpangetanungnaguguluhanhampaslupawarinakikiaaktibistamagkapatidsang-ayonkahaponawang-awapinangalanannagwagipumulotkabutihanvidtstrakt