Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "people"

1. "The more people I meet, the more I love my dog."

2. A lot of people volunteer their time and resources to help those in need.

3. A wedding is a ceremony in which two people are united in marriage.

4. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

5. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

6. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

7. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

8. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

9. All these years, I have been surrounded by people who believe in me.

10. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

11. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

12. Baby fever can affect people of various ages, backgrounds, and genders.

13. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

14. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

15. Cars, airplanes, and trains have made it possible for people to travel great distances in a relatively short amount of time

16. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

17. Coffee is a popular beverage consumed by millions of people worldwide.

18. Coffee shops and cafes have become popular gathering places for people to socialize and work.

19. Cutting corners on food safety regulations can put people's health at risk.

20. Dogs can provide emotional support and comfort to people with mental health conditions.

21. Einstein's writings on politics and social justice have also had a lasting impact on many people.

22. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

23. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

24. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

25. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

26. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

27. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

28. I hate it when people beat around the bush instead of just getting to the point.

29. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

30. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

31. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

32. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

33. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

34. It's frustrating when people beat around the bush because it wastes time and creates confusion.

35. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

36. Leukemia can affect people of all ages, although it is more common in children and older adults.

37. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

38. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

39. Many people experience stress or burnout from overworking or job dissatisfaction.

40. Many people go to Boracay in the summer.

41. Many people start their day with a cup of coffee to help them wake up and feel more alert.

42. Many people think they can write a book, but good writers are not a dime a dozen.

43. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

44. Many people work to earn money to support themselves and their families.

45. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

46. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

47. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

48. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

49. Money has value because people trust that it can be used to purchase goods and services.

50. Musk has been named one of the most influential people in the world by TIME magazine.

51. Nationalism has been used to mobilize people in times of war and crisis.

52. One of the most significant impacts of television has been on the way that people consume media

53. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

54. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

55. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

56. Owning a pet can provide a sense of purpose and joy to people of all ages.

57. People can also borrow money through loans, credit cards, and other forms of debt.

58. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

59. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

60. People who give unsolicited advice are a dime a dozen.

61. Protecting the environment involves balancing the needs of people and the planet.

62. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

63. Quiero ser una influencia positiva en la vida de las personas que me rodean. (I want to be a positive influence in the lives of people around me.)

64. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

65. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

66. Some people argue that it's better not to know about certain things, since ignorance is bliss.

67. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

68. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

69. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

70. Some people have a sweet tooth and prefer sweet flavors over others.

71. Some people invest in cryptocurrency as a speculative asset.

72. Some people like to add a splash of milk or cream to the beaten eggs for a creamier texture.

73. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

74. Some people view money as a measure of success and achievement, while others prioritize other values.

75. Sweetness can be a source of comfort and pleasure for many people.

76. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

77. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

78. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

79. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

80. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

81. The invention of the telephone and the internet has revolutionized the way people communicate with each other

82. The king's role is to represent his country and people, and to provide leadership and guidance.

83. The king's subjects are the people who live in his kingdom and are under his rule.

84. The momentum of the protest grew as more people joined the march.

85. The pursuit of money can have both positive and negative effects on people's lives and relationships.

86. The rise of digital currencies and payment systems is changing the way people use and think about money.

87. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

88. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

89. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

90. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

91. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

92. The uncertainty of the job market has led to many people rethinking their career paths.

93. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

94. The website has a lot of useful information for people interested in learning about history.

95. There were a lot of people at the concert last night.

96. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

97. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

98. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

99. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

100. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

Random Sentences

1. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

2. Jeg er nødt til at skynde mig, ellers kommer jeg for sent. (I have to hurry, otherwise I'll be late.)

3. Ang pagsusulat ng mga saloobin at damdamin sa pamamagitan ng journaling ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

4. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

5. Pumunta ang pamilyang Garcia sa Pilipinas.

6. Kung ano ang puno, siya ang bunga.

7. Nag-iisa kasing anak si Ranay.

8. Ang aming mga pangarap at layunin ay pinagsasama namin bilang magkabilang kabiyak.

9. Ang sabon na may pabangong rosas ay nag-iwan ng mabangong amoy sa aking balat.

10.

11. He was warned not to burn bridges with his current company before accepting a new job offer.

12. Patunayan mo na hindi ka magiging perwisyo sa kanila.

13. El cultivo de olivos es una actividad tradicional en el Mediterráneo.

14. Ibig niyang maranasan ang mga bagay na kaiba sa kinalakihan.

15. Minsan, nagkakaroon ng agam-agam sa isip ng mga magulang kapag nag-aalala sila sa kinabukasan ng kanilang mga anak.

16. Sa larong sipa, ginagamit din nila ang maliit na bola ng goma.

17. Ano pa ho ang kailangan kong gawin?

18. Si Rizal ay naglakbay sa Europa at nakikipag-ugnayan sa mga kilalang intelektuwal at lider sa paglaban sa kolonyalismong Espanyol.

19. Pinanood namin ang Ifugao kahapon.

20. Sa takip-silim, mas maganda ang kulay ng langit dahil sa kakaibang mga kulay.

21. Bumili siya ng dalawang singsing.

22. Hindi dapat natin hayaang mayroong paglapastangan sa mga pangalan ng mga namayapa.

23. Landbrugsprodukter, især mejeriprodukter, er nogle af de mest eksporterede varer fra Danmark.

24. Aanhin ko 'to?! naiiritang tanong ko.

25. The DNA evidence led to the arrest of the culprit in the murder case.

26. Para el Día de los Enamorados, mi pareja y yo nos fuimos de viaje a un lugar romántico.

27. Hindi ka ba napaplastikan sa sarili mo, tol?

28. Adik na ako sa larong mobile legends.

29. Ariana is an advocate for animal rights and follows a vegan lifestyle.

30. El invierno se caracteriza por temperaturas frías y, a menudo, por nevadas.

31. The business started to gain momentum after a successful marketing campaign.

32. Nogle helte er kendte for deres modige handlinger under krig.

33. Paano tayo? Di mo pa sinasagot yung tanong ko. aniya.

34. May pumupunta sa Seasite minu-minuto.

35. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

36. Ang lamig ng yelo.

37. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

38. Ako si Minervie! Ang dyosa ng dagat! Dahil sa kasamaan mo, parurusahan kita! Simula ngayon, hindi ka na maglalakad sa lupa

39. Ang salarin ay nagtago sa malalayong lugar upang makaiwas sa pag-aresto.

40. Kangina pa ako nakapila rito, a.

41. Naniniwala ka ba sa legend ng academy?

42. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

43. Det er også vigtigt at sætte et budget og begrænse sin risiko for at undgå at miste mere end man har råd til.

44. Salatin mo ang ibabaw ng mesa para makita kung may alikabok.

45. I got my sister a cake and wrote "happy birthday" in frosting on top.

46. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

47. Hindi dapat nating pabayaan ang ating mga responsibilidad sa buhay, samakatuwid.

48. Ang abuso sa hayop ay isang krimen na dapat mapanagot ang mga nagkasala.

49. Omelettes are a popular choice for those following a low-carb or high-protein diet.

50. Sumasakay ako ng taksi sa umaga araw-araw.

Similar Words

people's

Recent Searches

re-reviewpeoplejingjinglondonlaruinpaghuhugaslaganapvelfungerendekapalcompletamentemenspakibigaylalimunconstitutionaladvertisingcaraballolumiitakmangtelephonesalitasocialesinihandaaffiliatepeppynasankatagalihimhastaotherskatulongnasuklamangkopnahulaankumapitkaraniwanghumingibagkus,industrymaduraslandohiningiartistskahilinganbayanassociationpriestopohopelumulusobyaridagatnagmumukhawordbilanggokapatidmakapaibabawexammaskarasystematisknitongdisappointpangingimiihandapinakamaartengnagtatrabahomatigasnapakaramingjoshnatanggaphdtvhalalanconteststaplefar-reachingseriousitongpinatidmorenacenterricotradedailypagtatapospersonsplatformsnakablueumagawlibreredeksaytedbornnaroonmorehitlastingfistsnuclearpinunitoffer300nagpagupitfreelancing:tsaamapakaliinalokpasangmentalstevetripdatisumugodpersonal1973numberestablishedimpactedhapasinfourpotentialdebatesconditioningdigitalstoplightdeclaredulapracticadongunitceskababayangnapakaselosougattutorialssameexplaindevelopmentcontinuewritemulingdulowithoutlasingnegativetermheftyeditorsundhedspleje,pinagmamalakipagmasdankalayaanmahiwagangkaaya-ayanganumanartehumiwalaymalayangdininagbagoiloiloatensyongnapakabaitmayonakalabasniyapinalakinggratificante,usingconsidermovieisasagotvictoriakilongdistansyaelijepinapakingganhiningaespanyolbarung-baronguminomlumindolbutigearnanunurinanalosaranggolapangungutyanapakabagaldumagundongsonidogustongkapiranggotngingisi-ngisingpagsusulitnangangalitdagligekabilangcafeteriaoktubrehanginsumayajustin