Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "american"

1. Amazon is an American multinational technology company.

2. Ariana Grande is an American singer, songwriter, and actress known for her wide vocal range and powerful voice.

3. Donald Trump is a prominent American businessman and politician.

4. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

5. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

7. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

8. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

9. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

10. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

11. Presley's influence on American culture is undeniable

12. Tesla is an American electric vehicle and clean energy company.

13. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

14. Today, Presley is widely considered to be one of the most important figures in American music and culture

15. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

16. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

Random Sentences

1. Nagising si Rabona at takot na takot na niyakap ang kaniyang mga magulang.

2. Nous avons invité tous nos amis et notre famille à notre mariage.

3. Sa kalawanging medya-agwa niyon ay nakasilong ang iba pang agwador.

4. Si Hidilyn Diaz ay ang unang Pilipinong nakapag-uwi ng gintong medalya mula sa Olympics.

5. Puwedeng gamitin ang pagguhit upang mag-disenyo ng mga damit at mga bagay-bagay.

6. Umiinom si Andy ng vitamins kaya ang katawan nito ay bihirang magkasakit.

7. Me da miedo pensar en lo desconocido, pero al final, "que sera, sera."

8. Bumibili si Erlinda ng palda.

9. Sa mga sitwasyon ng buhay, ang mailap na oportunidad ay kailangan mabilis na kinukuha.

10. Kinakabahan ako para sa board exam.

11. Nagliliyab ang kalangitan sa gabi dahil sa mga paputok.

12. Sayang, jangan khawatir, aku selalu di sini untukmu. (Don't worry, dear, I'm always here for you.)

13. Samantala sa pag-aaral, iniinda niya ang mga pagsubok sa buhay.

14. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

15. Nagdala ako ng mga bagong libro sa silid-aralan upang makapagbahagi sa mga kaklase.

16. Pero sa isang kondisyon, kailangang bayaran mo.

17. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

18. Some viruses can cause cancer, such as human papillomavirus (HPV) and hepatitis B and C.

19. Ang talambuhay ni Juan Ponce Enrile ay nagpapakita ng kanyang malawak na karanasan sa pulitika at pamumuno.

20. Naglalaro ang walong bata sa kalye.

21. Up above the world so high,

22. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

23. Pumasok ako sa isang malaking kuwarto na halos hindi ko makita dahil sa sobrang pagdidilim ng mga ilaw.

24. Les travailleurs doivent respecter les heures de travail et les échéances.

25. Matagal ang pagluluto ng kare-kare.

26. Isang araw, ang katulong ng bagong Sultan ay humahangos at ibinalitang may isang punongkahoy na tumubo sa kinalilibingan ni Sultan Barabas.

27. Si Rizal ay kilala bilang isang makata, manunulat, pintor, doktor, at lider sa paglaban sa kolonyalismong Espanyol.

28. Pinahiram ko ang aking gamit pang-camping sa mga kaibigan ko para sa aming weekend getaway.

29. This has led to increased trade and commerce, as well as greater mobility for individuals

30. The legislative branch, represented by the US

31. The dancers are rehearsing for their performance.

32. This has led to increased trade and commerce, as well as greater mobility for individuals

33. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

34. Sa droga, hindi ka lamang nanganganib sa iyong kalusugan, kundi pati na rin sa iyong kaligtasan.

35. The company decided to avoid the risky venture and focus on safer options.

36. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

37. Lahat ay nakatingin sa kanya.

38. Many religious traditions believe that God is all-knowing, all-powerful, and benevolent.

39. Wag kana magtampo mahal.

40. "Dogs are better than human beings because they know but do not tell."

41. Sa pagguhit, mahalaga ang pagpili ng tamang kasangkapan tulad ng lapis, papel, at krayola.

42. Kumaripas si Mario nang mahulog ang kanyang sumbrero sa kalsada.

43. Ang taong walang tiyaga, walang magtatagumpay.

44. A couple of songs from the 80s played on the radio.

45. Ang kanyang ama ay isang magaling na albularyo.

46. Tuwid ang tindig nito at halos hindi yumuyuko kahit may pasang balde ng tubig; tila sino mang masasalubong sa daan ay kayang-kayang sagasaan.

47. When in Rome, do as the Romans do.

48. Simula noon ay hindi na nga nakikihalubilo si Paniki sa kahit anong hayop.

49.

50. Black Panther is the king of Wakanda and possesses enhanced strength, agility, and a suit made of vibranium.

Recent Searches

americanrosasempresasagwadorbesessnadennebingopinanoodeducationalpumansinkuwebapinangalananpinag-usapanhalamannagsmileganunracialmagkaibabyggethinimas-himasnakapasakwenta-kwentagobernadorsinimulankayabangankinakailangangkayhimigkayamag-ibainatinapaynasagutanuulaminsubalitnauliniganpartynag-oorasyonnakakapasokparangmaalwangnakalagaygenepinaikinakagalitpagtawabagkusnametaga-ochandoobservation,parusakinatatalungkuangnagpakitayoutubemajorpaboritokakayanankayang-kayangsinacarrieshinampasnandyannandiyankasisorrymaipagpatuloyiconevnegoalselebrasyonmakalaglag-pantybotenandoonnanditoganiddispositivotigaskuryenteuntimelybulaklaknangnangagsipagkantahanpelikulamagbungakinauupuantinahakpnilitnakakatawabagnaantigbroughtfactorespaglalabadahumiwalaykabiyakkinikilalangnatalongnalakijingjingganitomagtatagalkailangangmejotabiswimmingtalinopinalitanmaingayimportantesbalatnakatagopagbibironagtaposprimerosmatalimstopinagkiskisinastamanipisexigentehumihingirocknamumulaklakbrainlyconkumukuhanadamapinagkakaabalahanpinagbubuksanairplanesearlypinsanipapainitkasakitpintuanspecialupuanbuung-buonangangakoipinadalagearfeelsuriinpromoteyeheytelatherapeuticsschooljunjundiyannagngangalangmaipapautangmagtigilpagtatakaverdentungkolmaglalabing-animmasayang-masayanakakapagpatibaykumitagawinhouseholdnaritotumiramalumbaypatuloysasatahanankahaponromerogabimahahawahydelwalongalamvetocementedkalaunandakilangngangseryosoneaipinabalikconvertidasdyipnagalitsupilinikinagalithinatidchoinapakasinungalingsenatenilaoscenterwakaspalaisipanattractivenabiawangamplia