Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "american"

1. Amazon is an American multinational technology company.

2. Ariana Grande is an American singer, songwriter, and actress known for her wide vocal range and powerful voice.

3. Donald Trump is a prominent American businessman and politician.

4. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

5. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

7. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

8. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

9. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

10. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

11. Presley's influence on American culture is undeniable

12. Tesla is an American electric vehicle and clean energy company.

13. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

14. Today, Presley is widely considered to be one of the most important figures in American music and culture

15. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

16. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

Random Sentences

1. May problema ba? tanong niya.

2. Ang pagkakaisa ng buong nayon sa panahon ng krisis ay lubos na ikinagagalak ng kanilang lider.

3. L'auto-évaluation régulière et la mise à jour de ses objectifs peuvent également aider à maintenir une motivation constante.

4. Pakibigay sa amin ang detalyeng kailangan para maayos naming magawa ang proyekto.

5. Fødslen kan være en tid med stor stress og angst, især hvis der er komplikationer.

6. Ang carbon dioxide ay inilalabas ng mga tao.

7. Humarap sakin si Nathan, Kumain na ba kayo?

8. Ugali mo panget! Bitawan mo nga ako! Sisipain na kita!

9. Ok. Alam mo, isa pa yung excited na magka-apo eh.

10. Mathematical proofs are used to verify the validity of mathematical statements.

11. Nakapila ako sa bayad center upang magbayad ng kuryente.

12. Sino ang kinukuha ng mga sundalo?

13. Nang siya'y mapaibabaw, sinunud-ssunod niya: dagok, dagok, dagok.

14. Transkønnede personer har ret til at udtrykke deres kønsidentitet uden frygt for vold eller diskrimination.

15. Ang mahal pala ng ticket papuntang Amerika!

16. Nakita niyang lumalakad palayo ang kaibigan, na tila may tinatago.

17. Los héroes son aquellos que demuestran una actitud valiente y una voluntad inquebrantable.

18. Napilitan silang magtipid ng tubig dahil sa patuloy na tagtuyot.

19. Hindi na sila nasisiyahan sa nagiging asal ng bata.

20. Ang mga mamamayan sa mga lugar na mayaman sa tubig-ulan ay dapat mag-ingat sa pagtatapon ng basura upang maiwasan ang pagbabara ng mga daluyan ng tubig.

21. Sa kaibuturan ng kanyang damdamin, mahal niya ang kanyang mga kaibigan.

22. Umiiyak ang langit sapagkat tuyo na ang lupa.

23. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

24. Nagbenta ng karne si Mang Jose kay Katie.

25. Hindi ko ho makain dahil napakaalat.

26. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

27. Bumili sila ng bagong laptop.

28. Agama sering kali menjadi sumber inspirasi dan motivasi bagi individu dalam menghadapi tantangan hidup dan mencari makna dalam eksistensi mereka.

29. At hanggang ngayon nga ay pinatutunayan pa rin ng mga aso na sila ay tapat sa kanilang mga amo.

30. Pantai Kuta di Bali adalah salah satu pantai terkenal di dunia yang menawarkan pemandangan matahari terbenam yang indah.

31. Nangangaral na naman.

32. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

33. Nag-alok ng tulong ang guro sa amin upang matugunan ang mga hamon ng bagong kurikulum.

34. Me cuesta respirar. (I have difficulty breathing.)

35. I am not planning my vacation currently.

36. Omelettes are a popular choice for those following a low-carb or high-protein diet.

37. Television is a medium that has become a staple in most households around the world

38. Beauty. maya-maya eh sabi ni Maico.

39. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

40. Keluarga sering kali memberikan hadiah atau uang sebagai bentuk ucapan selamat kepada ibu dan bayi yang baru lahir.

41. The Tesla Model S was the first electric car to have a range of over 300 miles on a single charge.

42. I have been taking care of my sick friend for a week.

43. Ang pagbisita sa isang silid-pahinga o spa ay nagbibigay sa akin ng isang matiwasay na karanasan ng kalinisan at kaginhawaan.

44. ¿Cuántos años tienes?

45. Lending money to someone without collateral is a risky endeavor.

46. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

47. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

48. Nosotros preparamos una gran cena para celebrar la Nochebuena.

49. Las fiestas invernales, como el Día de Reyes, traen alegría y celebraciones.

50. Hindi malaman kung saan nagsuot.

Recent Searches

imbesmaayosamericankasaysayaneffektivattentionmournedsipaonlinealexandernapatingalakikomagisingindiakasingtigassigarelativelyandamingeffortsmedievalpanaysearchmestorugadettecanadasaidremainyeppicsmeetdatapwatrestawantodayunderholderyelonilangfakepinaladmaskproperlykahirapannaantigisinamabosesangeveninggenerationerharmfultrackdeleputahematabafiguresknowsbranchesmemo2001face1982cornerpag-aaralangipapahingaderipongtalebulaenforcinglockdownclearclockconvertingsalapimethodsdecreasetipcasesbroadcastingbetweenrequirecommunicateinternalmalusognanahimikwhatsappklasesinaliksiknagpaiyakpumapaligidpakistangiyeranakahugneed,makauwipatutunguhaninternetautomationpracticesvaledictoriandesisyonanrinkaharianmaghatinggabihudyatnakalipaspagamutanguidemalasutlamakaratingsidopalapagwidespreadusabotehimtwomakikipag-duetotemperaturakaninamenuligalignakatunghayaguapasalamatanjolibeepagbabagong-anyogeologi,kinikitapag-aapuhapkumakalansingmagalingpangkatsakamakuhabinibiyayaanhospitalpagsalakayobra-maestranagngingit-ngitalikabukinnagandahanbaranggaymalezakakaininpagkuwanlalakimananalopagkabuhaybumisitapagdukwangpaki-drawingmahiwaganagpakunotpamagatmadungisnapatulalamagpahababyggetinakalajingjingprimeroswatawatkulungansabihinnilaossakalinglumipadpapalapitgawaingusuariosasakaynahahalinhannaglaonhagdanankesokinalakihanbutterflyincredibleandreaitinaashanapinattorneyhalinglingumuponatatanawexigentehinagiskaarawansiranaiwangexcitedbutasprobinsyadiliginkakayananagostolakadlilikobihasanye