Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "empresas"

1. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

2. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

3. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

4. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

Random Sentences

1. Les personnes âgées peuvent souffrir de diverses maladies liées à l'âge, telles que l'arthrite, la démence, le diabète, etc.

2. Mahalagang ipaglaban natin ang ating kalayaan sa pamamagitan ng tamang pamamaraan.

3. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

4. Tiyak daw na bibili sila ng mga paninda niya.

5. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

6. Thanks you for your tiny spark

7. Después del nacimiento, el bebé será evaluado para asegurarse de que está sano y para determinar su peso y tamaño.

8. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

9. Siempre me preocupo demasiado por las cosas, pero debería recordar que "que sera, sera."

10. Alas-tres kinse na ng hapon.

11. Anong ginawa nya sayo? Sya ba nagpaiyak sayo?

12. Bumili si Pedro ng bagong bola para sa kanilang basketball game.

13. The bride looked stunning in her wedding dress, truly a beautiful lady.

14. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

15. Le marché boursier peut être un moyen de faire fructifier son argent.

16. Gawa ang palda sa bansang Hapon.

17. Excuse me, anong tawag mo sakin? nakangiting tanong ko.

18. Beauty is in the eye of the beholder.

19. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

20. Bestida ang gusto kong bilhin.

21. The community admires the volunteer efforts of local organizations.

22. I'm going through a lot of stress at work, but I'm just trying to hang in there.

23. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

24. Les ingénieurs appliquent la science pour créer des produits et des systèmes.

25. Ano-ano ang mga sangkap ng iyong spaghetti?

26. Ang tagumpay ng kanilang proyekto ay lubos na ikinagagalak ng kanilang grupo.

27.

28. Omelettes are quick and easy to prepare, making them a convenient meal option.

29. Magaling maglaro ng chess si Joseph.

30. Si Juan ay nadukot ang cellphone dahil sa isang magnanakaw sa kalsada.

31. Det kan omfatte spil som kasinospil, lotteri, sportsbetting og online spil.

32. A bird in the hand is worth two in the bush

33. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

34. Si Teacher Jena ay napakaganda.

35. The hospital had a special isolation ward for patients with pneumonia.

36. Limitations are the boundaries or constraints that restrict what one can or cannot do.

37. Ang mga nagliliyab na bulaklak sa hardin ay nagbigay ng makulay na tanawin.

38. Ang lugar na iyon ay tila isinumpa.

39. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

40. Ang kuripot ng kanyang nanay.

41. Foreclosed properties can be a good option for those who are looking for a vacation home or second property.

42. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

43. Ang dami daw buwaya sa kongreso.

44. Gracias por hacerme sonreír.

45. Mahirap kalabanin ang sakit na nagdadala ng agaw-buhay na pakikibaka.

46. Ibinigay ko ang aking panahon at atensyon sa pagtitiis ngayon upang makamit ang magandang kinabukasan.

47. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

48. Omelettes are a popular choice for those following a low-carb or high-protein diet.

49. Einstein was a refugee from Nazi Germany and became a U.S. citizen in 1940.

50. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

Recent Searches

empresasvedvarendepatawarinsalaminhinanakitamuyinlapisbakantegumigisingmaghihintaylagnatnapakabiliskakilalamasasabicultivationfrancisconatuloyeleksyonnapasukorecibirpampagandagasmenduwendemahigpitpayongbibigyanbook,nangingilidmakausapnatakottaksifavoruniversitiesparaanggaanoreynaganangbutoeksportenpatientmamarilnagdaosnatitiraupuansocialepondoo-orderself-defensemasaholwaiteranghelrestawranaaisshkumatokaminuntimelykuyamagigitingsalitangnyanmakinangcarlopalibhasamagtigilbagayviolencetalentmalumbaynuhparinelectoralbritishshinesbasahinvelstandassociationmalambingexhaustedkinain1954padabogrevolutionizedhumakbangpootspenttonightresignationdiagnosticelvispancitreachskypeiniinomshorttodolegendsstillpakainmemocontestjudicialnyatrasciendecoaching:labingburdenreservednamingbumababaconvertidasrhythmsumindididsurgeryshapingprivatenalasingdrewfonoshowtilatuluyantrainingmarkedaidareaipapainitvasqueslastingbarpaslitcomunicarsereallyannaskillthoughtssomepotentialincreasedmonetizinganak-pawisputingprogrammingautomaticmakapilingandroiditemsneedskundipinipisilyeahwaitwingsamakatwidnakaupoSumalakapagpamamasyalnagreplylibreunti-untimanuksowhethermagalangbalathumahangospahiramdragonspeechesaparadornagwo-workmamalasmatadepartmentkabighaklimaantesutilizanpangakopagdaminoongpaldarisehisginoomisahalljohnpaanomangingisdaagoskawayanatematandang-matandamahirapatapracticadolilimobstaclesrest