Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "data"

1. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

2. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

3. Elektronik kan hjælpe med at forbedre sikkerhed og beskyttelse af data.

4. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

5. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

6. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

7. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

8. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

9. Mathematics can be used to analyze data and make informed decisions.

10. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

11. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

12. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

13. Scientific data has helped to shape policies related to public health and safety.

14. The culprit behind the data breach was able to exploit a weakness in the company's security.

15. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

16. This can include reading other books on the same topic, interviewing experts, or gathering data

17. TikTok has faced controversy over its data privacy policies and potential security risks.

Random Sentences

1. Umiiyak ang langit sapagkat tuyo na ang lupa.

2. Kailan ba ang flight mo?

3. Nang maglakad ako sa tabing-dagat, nakakita ako ng mga maliliit na alon na mayabong na puting espuma.

4. Maraming mga uri ng droga, tulad ng marijuana, cocaine, heroin, at methamphetamine.

5. Bagamat modernong panahon na, marami pa rin ang pumupunta sa albularyo sa kanilang lugar.

6. At være transkønnet kan være en svær og udfordrende rejse, da det kræver en dyb forståelse af ens identitet og en følelse af mod og autenticitet.

7. The grocery store offers a variety of fresh produce, including fruits and vegetables.

8. Musk has been described as a visionary and a disruptor in the business world.

9. Kings may have ceremonial duties, such as opening parliament or receiving foreign dignitaries.

10. Omelettes are a popular choice for those following a low-carb or high-protein diet.

11. The use of emphasis is influenced by cultural and social norms.

12. That'll be 4,788.50 pesos ma'am.

13. Ang ganda na nang bagong Manila zoo.

14. Erfaring har lært mig, at kommunikation er nøglen til en vellykket virksomhed.

15. She has been baking cookies all day.

16. It is important to be patient and persistent, and to not get discouraged if you encounter obstacles along the way

17. Algunos artistas famosos incluyen a Leonardo da Vinci, Pablo Picasso y Frida Kahlo.

18. Wag na, magta-taxi na lang ako.

19. Marami kaming handa noong noche buena.

20. After months of hard work, getting a promotion left me feeling euphoric.

21. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

22. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

23. Mahalagang maging totoo sa ating mga sarili at sa mga taong nakapaligid sa atin, datapapwat ay may mga pagkakataon na tinatago natin ang ating mga tunay na damdamin.

24. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

25. She enjoys cooking a variety of dishes from different cultures.

26. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

27. Ang mga natatanging likhang-sining ay dapat na itinuring bilang mga obra ng kahusayan at katalinuhan ng mga artistang naglikha.

28. Higupin mo muna ang sabaw bago kainin ang noodles.

29. Nasa Cebu si Trina sa Disyempre?

30. Hindi siya puwedeng uminom ng beer.

31. Pasensya na, kailangan ko umalis ng maaga.

32. TikTok has faced controversy over its data privacy policies and potential security risks.

33. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

34. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

35. Paano ho ako pupunta sa palengke?

36. Todos necesitamos algo en qué creer y esperar en la vida. (We all need something to believe in and hope for in life.)

37. The authorities were determined to find the culprit responsible for the environmental damage.

38. No puedo controlar el futuro, así que "que sera, sera."

39. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

40. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

41. Nagpapantal ka pag nakainom remember?

42. Sa loob ng simbahan, natatanaw ko ang magandang retablo at mga banal na imahe.

43. In addition to his musical career, Presley also had a successful acting career

44. Pagkaraa'y nakapikit at buka ang labing nag-angat siya ng mukha.

45. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

46. Ibinigay ni Aling Marta ang kanyang pangalan at tinitirhan at pagkatapos ay tuwid ang tinging lumayo sa karamihan.

47. The legislative branch, represented by the US

48. The decision to release the product early was a risky but ultimately successful strategy.

49. Sa loob ng zoo, pinagmamasdan niya ang mga hayop na naglalaro sa kanilang kulungan.

50. Hawak niya yung kamay ni Gelai habang palapit sa amin.

Similar Words

datapuwaDatapwatdatapuwat

Recent Searches

dataeffectsequeinteractbehaviorpackagingknowworkingdiyanpagsasalitakumukuhanagtrabaholabing-siyamipinatawagkayabulaklakmatumalinterests,pakistangagamitanumanexpediteditimkalakihanhardiniyakpatienceigigiitdeterminasyonmatapangalexandernakasuotaffectgamerubberorugaatento1000dinibridelarrylibertariancouldbroadtiposmakasalanangpacienciamakakakainhinahanapguidenanunuksomakakalimutinnakalipassofafrogcellphonenagalittumakasmagigitingnagsamahanggangnabigyankainitancitizensmakakanakakamanghaofficemuchaslaruanitanongkusinatanonglawayevolucionadogatollatenai-dialkilalang-kilalatig-bebeinteworkshoppiecesinfusioneslaranganpinangalanangtatanghaliinclientesjackynakikihukaypagtatakamagpapakabaitnakikini-kinitaenfermedades,nagtutulunganmakapangyarihannagbiyayasumusulatsasagutinvidtstraktbumaligtadellanalugodmahahawanationalskillstamarawjuanpambansangguardaricaconclusion,pesobingbingsetyembrekindergartenstoplightitutolencompassesubocontestpakibigyanbeinteinsteadcakemakalaglag-pantyvasquesestardistansyatiniradormalasutlanasasabihanmagagandangaraw-arawarawpinapasayaasignaturamedikalhistoriatsinanatitiraresearch,angelajagiyanahahalinhanbisigleadingmenossantoabonoresignationawapedeexperiencesreallyhulingmakenapilingpagbabagong-anyogumagalaw-galawkinatatakutanpagka-maktolmagtatagalgratificante,punung-punonag-away-awaygapalamenchantedalas-diyespagsumamomakitanagkakakainnagpipikniknangampanyanakatunghaymakikikainmahihirapnagpagupitmakalipasnageespadahangagawinnagpabayadkonsultasyonproductividadnakapasahitanakakarinigatensyongkumikilosrebolusyonnakuhamahinanakakainmagbantaytumahannapapahintoumagawcorporationinilistanagsmileabut-abot