Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "death"

1. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

2. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

3. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

4. Einstein's brain was preserved for scientific study after his death in 1955.

5. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

7. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

8. In the years following his death, Presley's legacy has continued to grow

9. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

10. Smoking is a leading cause of preventable death worldwide.

11. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

Random Sentences

1. En invierno, los árboles pierden sus hojas y se vuelven caducos.

2. Fui a la fiesta de cumpleaños de mi amigo y me divertí mucho.

3. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

4. Makalipas ang siyam na buwan, isinilang ang isang napakalusog na batang babae.

5. Aling hayop ang nasa tabi ng puno?

6. Mayroong dalawang libro ang estudyante.

7. This is not the time to fall apart, pull yourself together and think clearly.

8. May email address ka ba?

9. May problema ka ba? Kanina ka pa tulala eh..

10. Binuksan ko ito at binasa yung nakalagay.

11. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

12. Paano mo pinalambot ang giniling na karne?

13. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

14. Nagbabaga ang usapan ng mga opisyal sa harap ng media dahil sa kontrobersiya.

15. Hindi dapat natin ipagkait sa mga kabataan ang agaw-buhay na pagkakataon sa edukasyon.

16. Ang parke sa amin ay mayabong na may malalaking puno at makukulay na mga dahon.

17. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

18. Hiram na libro ang ginamit ko para sa aking research paper.

19. Claro, puedes contar conmigo para lo que necesites.

20. Uanset ens religiøse overbevisning er påsken en tid til at fejre håbet om nyt liv og genfødsel.

21. They offer interest-free credit for the first six months.

22. Dumating ang hindi inaasahan ni Ranay.

23. Gusto ng ina na matuto si Pinang ng mga gawaing bahay, ngunit laging ikinakatwiran ni Pinang na alam na niyang gawin ang mga itinuturo ng ina.

24. Hinila niya ako papalapit sa kanya.

25. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

26. How I wonder what you are.

27. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

28. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

29. Pinagpalaluan ng mga empleyado ang kanilang manager dahil sa kanyang mahusay na pamumuno.

30. Nagbasa ako ng libro sa library.

31. Subalit ang mapayapa at matiwasay na pamumuhay ng mga taga-nayon ay biglang binulabog ng masasamang-loob.

32. Naglinis kami ng bahay noong Linggo.

33. Natutuhan ng mga mag-aaral ang talambuhay ni Heneral Luna at ang kanyang ambisyon para sa pagbabago ng bayan.

34. May dalawang puno sa harap ng bahay namin.

35. Les frais d'hospitalisation peuvent varier en fonction des traitements nécessaires.

36. The weather today is absolutely perfect for a picnic.

37. Limitar la ingesta de alcohol y cafeína puede mejorar la salud en general.

38. Ang tagumpay ng ating bayan sa larangan ng sports ay ikinagagalak ng buong bansa.

39. Viruses are small, infectious agents that can infect cells and cause diseases.

40. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

41. I don't think we've met before. May I know your name?

42. Matapos ang pagtatanghal, bagamat di man lang siya makangiti at makatawa, kitang-kita sa kaniyang mata ang kasiyahan.

43. Sorry.. pati ikaw nadadamay. E-explain ko na lang sa kanya..

44. Gusto ko pumunta, pero pagod na ako.

45. Les patients peuvent bénéficier de programmes de réadaptation pendant leur hospitalisation.

46. Nanood sina Pedro ng sine kahapon.

47. Las plantas de interior son populares para decorar espacios dentro de las casas u oficinas.

48. Matagal din bago napawi ang paninigas ng kanyang pigi.

49. Algunos fines de semana voy al campo a hacer senderismo, mi pasatiempo favorito.

50. Los héroes defienden la justicia y luchan por los derechos de los demás.

Recent Searches

deathnababakasmagpahabanapabuntong-hininganaabutannakahugcynthiabumahaexecutivepasalamatanhatingmahigpitpinangaralandisappointmanonoodbasahanelitehigaipagtanggollalakimaibabalikpumatolnanunuksoskyldeskagandahagnakapasailoiloalintuntuninagesmakasakaynakangitinag-eehersisyopuwedepatientnamulaklakalwayspagkatakotmaariunanpatakbonotmagkasabaybumuhossidotabasnauntogstyleuugod-ugodmungkahividtstrakttignanngaipinikitcakepatulognaliwanaganvaledictorianpatuloytinikmanpaulit-ulitdumarayolumabaslilysulinganrebolusyonimeldalabassariwahesushugisngumitiattractiveaudiencehumanosbumigaybumilininalibertynag-aalaynagtatampolaruinvideosocialnakakalayojoshkayapagkuwakonsentrasyonpnilitpalapitmagbalikmestduritalagaproperlybestnagbiyahecellphonepakisabijuegospinunittomorrowstreetsakinnapatigilentermanilbihanbarrerasdingdingmakikitulogbasketbolpupuntahanbotodejaanitobutchactornanghinginagtatakapanahonkulturtryghedmagagandanglasipipilitknowledgevednodnilangkinisscitizenfrasumagotmangkukulamnagpipiknikonlinebangkabulaklakngipinginamapagodmiralarawanleadbakantenag-iisangnagbabalamarkedparusahanrevolutioneretfiverrpinagwagihangcadenafull-timeburmarabenatingalanapapadaanteachingsbusregulering,nangumbidalangkaypandalawahandisyempretsetanganrailwayskumaenkinsematanggappinagsulatitinaponlingidedsapinalayasmethodsattorneymalusogmarketplacessementonghampaslupamatsingpatipakikipagbabagevne10thpag-ibigsumalastoplightdettepostcardbukodpoongstocksnakaupoeclipxeflyvemaskinerenergy-coalbumoto