Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "death"

1. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

2. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

3. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

4. Einstein's brain was preserved for scientific study after his death in 1955.

5. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

7. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

8. In the years following his death, Presley's legacy has continued to grow

9. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

10. Smoking is a leading cause of preventable death worldwide.

11. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

Random Sentences

1. Gelai, siya si Tito Maico. sabi ko sabay turo kay Maico.

2. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

3. Disculpe señor, señora, señorita

4. Red horse? Ikaw? nagtatakang tanong ni Genna.

5. Ang bilis naman ng oras!

6. The package's hefty weight required additional postage for shipping.

7. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

8. Ilang tao ang nagsidalo sa graduation mo?

9. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

10. Nagsagawa ng ritwal si Matesa upang sumpain ang anak ng mag-asawa.

11. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

12. El arte contemporáneo es una forma de arte que refleja las tendencias y estilos actuales.

13. Les enseignants peuvent être amenés à enseigner dans des écoles différentes en fonction de leurs besoins professionnels.

14. Ang mga engineer nagsisilbi upang mag-disenyo at magtayo ng mga imprastraktura para sa publiko.

15. Noon di'y nangalaglag ang lahat ng mga bunga ng punong-kahoy at natabunan ang katawan ni Sangkalan.

16. Makapiling ka makasama ka.

17. Hindi lahat ng kaibigan ay laging nandyan.

18. Saan nagtatrabaho si Roland?

19. Ang matanda ay malilimutin na kaya’t kailangan niya ng alalay sa pag-alala ng mga bagay.

20. ¿Me puedes explicar esto?

21. Ang tubig-ulan ay mahalaga sa pagpapanatili ng kalikasan at pangkabuhayan ng mga tao, kaya't mahalaga na ingatan at pangalaga

22. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

23. El estudio científico produjo resultados importantes para la medicina.

24. Ayaw ko ng masyadong maanghang/matamis.

25. Saan naman? nagtatakang tanong ko.

26. I know things are difficult right now, but hang in there - it will get better.

27. Magaling maglaro ng chess si Joseph.

28. Ang mahagway na katawan ni Kablan ay naging mahabang isda na may matulis na nguso at matatalim na ngiping parang kakain kaninuman.

29. Inakalang magugustuhan ng lahat ang ideya niya, pero tinanggihan ito.

30. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

31. Hindi ako sang-ayon sa mga desisyon ng aking mga magulang tungkol sa aking buhay.

32. Magkano ang halaga ng bawat isang blusa?

33. Hoy en día, el internet es una parte integral de la vida cotidiana.

34. Naulinigan ng makapangyarihang Ada himutok ng Buto.

35. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

36. Marami ang nagpasalamat dahil hindi naging kamukha ng sanggol ang kanyang ama at ina.

37. The act of forgiveness requires empathy and understanding, allowing us to see beyond someone's mistakes and recognize their humanity.

38. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

39. Nasi padang adalah hidangan khas Sumatera Barat yang terdiri dari nasi putih dengan lauk yang bervariasi.

40. El té verde se elabora con las hojas de una planta de hierbas llamada Camellia sinensis.

41. Hindi ko alam ang sagot, pero sa ganang iyo, ano ang dapat gawin sa sitwasyong ito?

42. Halos hindi niya narinig ang halingling ni Ogor.

43. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

44. My boyfriend took me out to dinner for my birthday.

45. The exchange of rings is a common tradition in many weddings.

46. He tried to keep it a secret, but eventually he spilled the beans.

47. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

48. Ang pagpapalit-palit ng oras ng pagtulog ay maaaring makapanira sa sleep cycle ng isang tao.

49. Nais sana kitang isama subalit hindi talaga maari ang mga kagaya ninyo sa aming kaharian.

50. El nacimiento puede ser un momento de alegría y emoción para la familia, pero también puede ser estresante y desafiante.

Recent Searches

researchdeathgalitchaddolyarmuladverselysumakitfreelancerinvestbehalfdividesdoonplanexitstagebaketrainingtiposhinagpishatingmobilestuffedaidfatalconsiderarhalikavisbeenideamagingpopulationconstantlyauthorlcdtargetyearputitooreporteducationalconectanjoycontinuesenforcingmaayosislalorenapartneroftesedentarykiloadditionallyeyemapadalinapilingrateasawaefficientusingtutorialsexamplethirdbituinsyncerrors,makapilingcomplexmediumpaceandreadulolutuinclassmateinaapisimplengdeclarenevernicemaratingreleasedworkingvansquatterslavebeforecreationuminomdarkroquepeteractionpotentialitlogcrossdosnothingdanceendnagginghispuedeisugawalangbobohigitparagraphskisapmatasinunodbrindarmadamimaawaingwordfiabinawilutopaghihirapguestspilingprocesotechnologiesnilanguniquewatchingsubjectma-buhayexistsettingeditdumaramiconvertinggitaracompletemisapootproperlybroughtmasdanharingjokeafterspentcivilizationbakitpartysufferprimerlawsmamanhikanpagkatakotkauntipamanhikansasamahannasunogindustrybilinstilleffortsfeedback,namplacemagpuntaheardawgisingbatofeltshowsownearncongresslamesasinipangulampostcardartsyariverylegendscomienzanritwalpshdilimpinalutospansthreeincreaseclientesetsflashgenerabasambitconsiderputingsamemapprogressprogrammingcontinueprogramming,