Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "death"

1. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

2. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

3. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

4. Einstein's brain was preserved for scientific study after his death in 1955.

5. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

7. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

8. In the years following his death, Presley's legacy has continued to grow

9. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

10. Smoking is a leading cause of preventable death worldwide.

11. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

Random Sentences

1. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

2. Ngunit lumakas ang agos ng ilog, at napailalim sa tubig ang mag-aama.

3. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

4. Tengo que tener paciencia para lograr mi objetivo.

5. If you spill the beans, I promise I won't be mad.

6. La paciencia nos ayuda a controlar nuestras emociones.

7. Tinawag nilang ranay ang insekto na katagalan ay naging anay.

8. Ako ay bumili ng lapis sa tindahan

9. Kumain na kami ng tanghalian kanina.

10. Ibinigay niya ang kanyang tiwala sa akin upang mamuno sa proyekto.

11. Kanino ka nagpagawa ng cake sa birthday mo?

12. Puwedeng hiramin mo ang aking laptop habang inaayos ang iyong sarili?

13. Ang mailap na kaligayahan ay kailangan hanapin ng mabuti.

14. Walang kasing bait si daddy.

15.

16. Cultivar maíz es un proceso muy gratificante, ya que el maíz es una de las principales cosechas en todo el mundo

17. Kumunot lang ang noo ko, That's not my name.

18. In der Kürze liegt die Würze.

19. Make sure to keep track of your sources so that you can properly cite them in your book

20. Ang aking kabiyak ay ang aking katuwang sa buhay, nagbibigay ng tulong at suporta sa bawat yugto ng aming paglalakbay.

21. Excuse me, anong tawag mo sakin? nakangiting tanong ko.

22. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

23. Me siento cansado/a. (I feel tired.)

24. For you never shut your eye

25. Ang carbon dioxide ay inilalabas ng mga tao.

26. Marahil ay hindi pa ito ang tamang panahon upang magpakasal.

27. Ang buhay ay parang gulong, minsan nasa ibabaw, minsan nasa ilalim.

28. Puwede ka ring magguhit ng mga larawan ng kalikasan upang magpakita ng pagmamahal sa ating planeta.

29. Who needs invitation? Nakapasok na ako.

30. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

31. Ang mabuting kaibigan, ay higit pa sa kayamanan.

32. Magkaiba ang disenyo ng mga blusa namin.

33. Nagliliyab ang puso ni Andres sa pagmamahal para sa kanyang pamilya.

34. Bagay na bagay kayong dalawa. Paano ba kayo nagkakilala?

35. The sports center offers a variety of activities, from swimming to tennis.

36. Nag-iisa siya sa buong bahay.

37. Agad naman na ngpunta si Aling Edna sa bahay nila na daladala ang parte nila sa napaghatian na gulay at bigas.

38. Limitations can be a result of fear or lack of confidence.

39. Nagkagulo sa palengke at kumaripas ng takbo ang mga tao dahil sa maling akalang may sunog.

40. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

41. Omelettes are a popular choice for those following a low-carb or high-protein diet.

42. A quien madruga, Dios le ayuda. - The early bird catches the worm.

43. Gusto kong malaman mo na may ganitong pakiramdam ako, kaya sana pwede ba kita ligawan?

44. Maiba ako Ikaw, saan ka magpa-Pasko?

45. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

46. Kumukulo na ang aking sikmura.

47. Ang taong hindi marunong lumingon sa pinanggalingan, ay hindi makakarating sa paroroonan.

48. Es importante reconocer los derechos y la dignidad de todas las personas, incluidas las personas pobres.

49. Ano ang pangalan ng hotel ni Mr. Cruz?

50. Maarte siya sa kanyang kagamitan kaya hindi siya nagpapahiram ng kanyang mga bagay.

Recent Searches

biroraildeathtig-bebentepaidperlapingganbluevampireshamakscientificdilimreservescommunityparagraphsveryleadmapwhilebitbittwoshiftelectstyrergapinterviewingeffectstuwingtelephonemagugustuhancouldestablishedconditioningevilplandaigdigtrueplatformsbrideeksaytedlockdownkangitanmagagandainakalangpwestotmica1960skinamumuhiannapakagandangcleanbusognag-iisakababayannagpaiyakpagiginganaykumpletotablemaasahanpalasyovoteskidkiraniniinomnakakainnaiinistungocourtlibrengbanalnoodsugatangnagtitindanakisakaysandwichhayaangpagkakayakaptwitchkasabaykinalimutantangingjacehuwebesrosaberkeleymaglalarooperativosmag-inasarilingnakatiraheartbeatdealhihigitantesnahantadhanapinobservation,riegamasungitpumikituwaksakenmaibamenstindahanmahahalikkasiyahanpinagbigyantinutoptagtuyotmorningexhaustionerlindatumahimiknakuhangpinakabatangmakahirammbricoskabighatsonggosumalakaylumiitsukatinpalantandaanpinangaralannakauslingpagdiriwangbayadnagwalisbigotetiketpresyotransmitidasdyipdalagangbumigaykagandazoolenguajekaarawanbringsalatinmagsasalitagayunpamannapakamisteryosotabinakalagaysalemaihaharapsabadongkaloobangpresidentialpinapakiramdamanpagkakamalinapakatagalnanghihinamadposporostevelinggongtinawagnaiilangadgangpacienciamaghahatidsinaliksiknakakatandadisfrutarmabihisannakauwikasalukuyannagreplykommunikerernangapatdanberegningeraga-agajingjingsagutinkinumutanmaanghangisinuotkanginaskyldes,masaholjosiehonestoginawaranmagamotnanangisvidtstrakteksempelnatatawasinisirapakukuluanbuwenasbutikingipinyungtekagawamayamangatensyon