Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "death"

1. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

2. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

3. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

4. Einstein's brain was preserved for scientific study after his death in 1955.

5. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

7. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

8. In the years following his death, Presley's legacy has continued to grow

9. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

10. Smoking is a leading cause of preventable death worldwide.

11. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

Random Sentences

1. Libre si Clara sa Sabado ng hapon.

2. Ikinagagalak kong makita kang masaya sa bagong kabanata ng iyong buhay.

3. Limitations can be viewed as opportunities for growth and personal development.

4. Les travailleurs peuvent travailler à temps plein ou à temps partiel.

5. The politician tried to keep their running mate a secret, but someone in their campaign let the cat out of the bag to the press.

6. Dahil sa pagtaas ng populasyon sa bansa, yumabong ang pagtatayo ng mga condominiums at mga townhouses.

7. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

8. Congrats Beast! Proud girlfriend here! natatawang sabi ko.

9. Malapit ang eskuwela ko sa bahay namin.

10. Human trafficking is a grave crime that needs immediate action worldwide.

11. The love that a mother has for her child is immeasurable.

12. Inutusan nga lang ho niya kong bumili ng ulam, para mamayang tanghali.

13. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

14. Matagal-tagal na siyang tulala, hindi niya alam kung ano ang gagawin.

15. Nasi goreng adalah salah satu hidangan nasional Indonesia yang terkenal di seluruh dunia.

16. Cheating is a breach of trust and often a violation of the expectations and commitments of a relationship.

17. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

18. Ang lakas mo uminom wala ka naman ambag.

19. Sa pagtitipon ng mga lider ng relihiyon, ibinahagi nila ang kanilang mga mungkahi upang mapalakas ang pananampalataya ng mga miyembro.

20. I know you're going through a tough time, but just hang in there - you're not alone.

21. Elije el lugar adecuado para plantar tu maíz

22. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

23. En mi huerto, tengo diversos cultivos de flores y plantas ornamentales.

24. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

25. Ang rebolusyon ay bunga ng pagkamulat ng mga Pilipino kontra kastila.

26. You can't judge a book by its cover.

27. Los sueños son el motor que nos impulsa a lograr nuestras metas. (Dreams are the engine that drives us to achieve our goals.)

28. His films, teachings, and philosophy continue to inspire and guide martial artists of all styles

29. Nangangako akong pakakasalan kita.

30. He has bigger fish to fry

31. Me siento cansado/a. (I feel tired.)

32. Isang mahigpit na tunggalian ang naganap sa gitna ng kabanata, na nagbigay daan sa pagbabago ng landasin ng kuwento.

33. Hindi sadyang nagkaubusan ng pagkain sa aking ref.

34. Electric cars are quieter than gasoline-powered cars due to the absence of an internal combustion engine.

35. The disagreement between them turned out to be a storm in a teacup.

36. Ang mga ideya ni Rizal tungkol sa pagkakapantay-pantay, edukasyon, at pagkakaisa ay patuloy na nagbibigay-inspirasyon sa mga Pilipino.

37. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

38. Les patients peuvent avoir besoin de soins palliatifs pendant leur hospitalisation.

39. The value of money can fluctuate over time due to factors such as inflation and changes in supply and demand.

40. Hindi mo gusto ang alok na trabaho? Kung gayon, maaari kang maghanap ng ibang oportunidad.

41. Ano ang alagang hayop ng kapatid mo?

42. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

43. Sa aming barangay, nagkaroon ng malawakang paglilinis ng kanal dahil sa bayanihan ng mga residente.

44. Sa tagal nilang nagsama ay hindi sila pinalad magkaroon ng anak

45. Pantai Sanur di Bali adalah pantai yang menawarkan pemandangan matahari terbit yang indah dan tempat yang bagus untuk bersantai.

46. Det har også ændret måden, vi interagerer med teknologi

47. En casa de herrero, cuchillo de palo.

48. Air tenang menghanyutkan.

49. Paano niya malilimutan si Ogor? Sa mula't mula pa, itinuring na siya nitong kaaway, di kailanman binigyan ng pagkakataong maging kaibigan.

50. Det har også ændret måden, vi planlægger og styrer vores transport, såsom selvkørende biler og flyvemaskiner med automatisk navigation

Recent Searches

binabalikdeathsparkbokpasyascientistnakaka-bwisityeyveduponaghuhumindigfaultsingercigarettepaslitplaysbusshockspaghettiiosteamstoserrefnageespadahanmagbubungacorrectingochandoalinlabanansafeimprovenothingdarkdingginredonenyagusting-gustodataprogramminglcdclockbroadcastingsettingapollosummitlargetwofacultydondehadallowinggodbahay-bahayancanbugbuginbadapppupuntahandumaramipeer-to-peeranonakitanag-oorasyonamo300lockednakapagreklamosalamangkerobumahamarianmakakatakasdyanparatingeskuwelahaneducationalengkantadaambisyosangrespektivepinaliguanpagraranasmonetizingpagkamulatpagdidilimpetsanagpabayadaggressionprobinsyanareklamolumilipadkapamilyananaisinimposiblebilingspeechesrevolucionadosapagkatreturnedpag-iyaknai-dialsana-alladverselycuentanendvidereartistapag-aanipakanta-kantangkwelyoeconomypapapuntasinundoencounterespanyanglabinsiyampanindanapatawagnakakaanimnationalreplacedmakabawiasthmahuwebeshalinglingworkshopconclusion,fertilizeremphasiskumukuhamakikipag-duetoagricultoresnamumulaklaknangagsipagkantahanmisteryopinahalataalas-diyeskuwartonalalaglagnanghihinamarketplacespagpasensyahannagandahanmusiciansabadongnakakabangonpansamantalapagkasabimakalipaspalaisipanaplicacionesunattendedmakatarungangnabighaninapakasipagmagpapagupitpaglalabadabeginningbunganaiilanglumayohimihiyawnasasalinanmagbaliklumamangmakakiboactualidadmedikalsinaliksikjeepmagdamagantungkodsay,estasyonsanggolnagbabalangumingisinangangakodistanciapaghuhugasisinuotmanirahanbilibidproducererbalikatlabisnakainomnapansinlungsodginagawapagdiriwangprincipalesdiyaryokaraokepromisenatakotmaaksidentecramenawalanamilipitpumikit