Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "track"

1. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

2. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

3. Make sure to keep track of your sources so that you can properly cite them in your book

4. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

5. The project is on track, and so far so good.

Random Sentences

1. Medarbejdere kan blive tvunget til at arbejde hjemmefra på grund af COVID-19-pandemien.

2. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

3. Sa mga kasal, kadalasan ay mayroong programa ng sayawan upang mas masaya ang pagdiriwang.

4. Nang tayo'y pinagtagpo.

5. Ang ganda pala sa enchanted kingdom!

6. Nais ko sanang malaman ang mali sa katotohanan

7. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

8. Eto isuot mo. binigay ko sa kanya yung dress na binili ko.

9. Gracias por ser una inspiración para mí.

10. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

11. Ito na yata ang pinakamatabang babae na nakilala niya.

12. Ang mabuting kaibigan, ay higit pa sa kayamanan.

13. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

14. Captain America is a super-soldier with enhanced strength and a shield made of vibranium.

15. Emphasis can be used to express emotion and convey meaning.

16. Sandali na lang.

17. He used TikTok to raise awareness about a social cause and mobilize support.

18. Saan itinatag ang La Liga Filipina?

19. Der er forskellige identiteter inden for transkønnethed, herunder non-binær og genderfluid.

20. La paciencia nos da la fortaleza para seguir adelante.

21. All these years, I have been learning to appreciate the present moment and not take life for granted.

22. Lingid sa kaalaman ng prinsesa gayundin ang nararamdaman ng bagong kakilala sa kanya.

23. Ang mga nanonood ay para-parang nangapatdan ng dila upang makapagsalita ng pagtutol.

24. Aba oo, yun lang pala, nakakunot-noong sagot ni Kablan.

25. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

26. Sa pakikipag-ugnayan sa ibang tao, huwag magpabaya sa pakikinig at pang-unawa sa kanilang mga saloobin.

27. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

28. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

29. The river flows into the ocean.

30. It was supposed to be a surprise promotion, but the boss let the cat out of the bag during a meeting.

31. Nagagandahan ako kay Anna.

32. Kumaripas ng lakad ang matanda nang bumilis ang ulan.

33. Agaw eksena ang babaeng himihiyaw sa palengke.

34. Samantala sa malamig na klima, nag-aalaga siya ng mga halaman sa loob ng bahay.

35. Sa halip na maghanap, sinalat na lang niya ang ibabaw ng mesa para sa relo.

36. The uncertainty of the situation has made it difficult to make decisions.

37. Itinapon nina Fred at Melvin ang basura

38. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

39. Research and analysis are important factors to consider when making investment decisions.

40. Kucing dapat dilatih untuk melakukan beberapa trik seperti menjulurkan tangan untuk berjabat tangan atau melompat melalui ring.

41. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

42. Dedication is the fuel that keeps us motivated, focused, and committed to achieving our aspirations.

43. El momento del nacimiento marca el inicio de una nueva etapa en la vida de los padres.

44. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

45. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

46. Hindi maikakaila, mas malakas ang pamilyang magkakasama.

47. Kumaliwa ka papuntang Masaya Street.

48. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

49. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

50. Ang buhay at mga akda ni Rizal ay patuloy na pinag-aaralan at pinag-aaralan ng mga estudyante at mga historyador sa buong mundo.

Recent Searches

trackorganizenalamanpesoginilingyeloisaaccaketumunogsulinganhikingvehiclesnagawangpartykapeteryanakapagngangalitnabalitaanpinabulaanbarcelonasingsingpartiesnagbababamininimizemalawakblazingna-curiouscigarettefionavidtstraktintoavailableabswalasumunodlinenawalangramonrenacentistamauliniganhawlacasapelikulamanggagalinghumigagayundinpusapinangalanangtradetiemposdropshipping,gracetog,generationeryepbutihingtumigilsumigawnaglalakadtsinelashoneymoonnapakahabamakakayasakalingkahilinganmaliwanagmoodsquatterprobinsyaiikotpagsidlanltodiagnosticeventsiyonmaligayafysik,befolkningen,dyipnitraditionaltelecomunicacioneshouseshadesreviewiloilodekorasyonexpeditednakalockipapainitlarawanyespasaheromagandangnakahugmataaaspagkagustonovemberexperience,sabihinmalapitanricoparonapakasinungalingbumitawnoonpasahenagtatrabahodamdaminnararapatikinamatayinformationpagkaimpaktolastinghurtigerepagbatimartessabong2001japanstorybulaumigibtsaamacadamiawouldunosnagkakasyadettemaaringelvisshouldsipatrycycleprogressoutpostlasingpracticadoceslumilipadlihimmakausapuniversitysaranggolabigasdistanciasalitangusuariokinahuhumalinganpinagmetodeyeheyipantalopsampungabonoetoflexiblenakapapasonghinintaybilhinsarita1977nagdabogkumatoktabasheyamerikawordrollpedekinagalitankalikasanbroadpwestomantikaschoolssaraevolucionadodiscoveredkelanpaga-alalanakilalainsidentedanceplasakasingtigasthenenhederikinagagalakpalagimediumimpactedtusongbitbitguidancesalu-salolaguna1940matakawmethodsbibisitapresko