Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "movies"

1. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

2. Brad Pitt is known for his charismatic performances in movies such as "Fight Club" and "Ocean's Eleven."

3. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

4. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

5. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

6. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

7. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

8. Scarlett Johansson is a prominent actress known for her roles in movies like "Lost in Translation" and as Black Widow in the Marvel films.

9. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

10. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

11. They watch movies together on Fridays.

12. Tom Cruise is a highly successful actor known for his roles in movies like "Top Gun" and the "Mission: Impossible" series.

13. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

Random Sentences

1. Tinulungan ko siyang dalhin yung mga plato sa dining room.

2. ¿Cuánto cuesta esto?

3. Limitations can be a result of fear or lack of confidence.

4. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

5. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

6. Aba, kangina ba namang pumapasok ako sa palengke, e banggain ako, sabi niya.

7. Si Pedro ay namamanhikan na sa pamilya ni Maria upang hingin ang kanilang pahintulot na magpakasal.

8. El cultivo de olivos es una actividad tradicional en el Mediterráneo.

9. Ang pagiging malilimutin ni Ana ay laging nagdadala ng problema sa kanilang grupo.

10. Cryptocurrency operates independently of central banks and governments.

11. Las heridas en las extremidades pueden requerir de vendajes compresivos para detener el sangrado.

12. Hindi ko gusto ang takbo ng utak mo. Spill it.

13. Halos dalawang linggong nag quarantine ang pamilya ni Josie matapos mag positibo sa covid.

14. Malakas ang kamandag ng ahas na nakatuklaw kay Mang Arturo.

15. May problema ka ba? Kanina ka pa tulala eh..

16. Palibhasa ay may kakayahang magpakatotoo at magpahayag ng kanyang mga saloobin nang malinaw at mahusay.

17. The United States has a system of federalism, where power is divided between the national government and the individual states

18. Nationalism can be a source of conflict between different groups within a nation-state.

19. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

20. Kailangan nating magsimula sa pagkakaroon ng pangarap upang magkaroon ng inspirasyon sa buhay.

21. Frustration can be a sign that we need to reevaluate our approach or seek alternative solutions.

22. Si Andres ay pinagpalaluan ng kanyang mga kaibigan dahil sa kanyang tapang at determinasyon.

23. Nasa Cebu si Trina sa Disyempre?

24. Kulay pula ang libro ni Juan.

25. Los héroes a menudo arriesgan sus vidas para salvar a otros o proteger a los más vulnerables.

26. Mabait ang mga kapitbahay niya.

27. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

28. Emphasis can help to ensure that a message is received and understood by the intended audience.

29. Comer saludable es esencial para mantener una buena salud.

30. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

31. Magkita tayo sa parking lot ng Luneta Park.

32. The game is played with two teams of five players each.

33. Mommy. ani Maico habang humihingal pa.

34. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

35. Malaki ang kanilang rest house sa Tagaytay.

36. Nakatulog ako sa klase at nagitla ako nang biglang sumigaw ang guro sa aking tenga.

37. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

38. Araw araw niyang dinadasal ito.

39. Puwede bang pahiram ng konting oras mo para mag-usap tayo?

40. Two heads are better than one.

41. Gusto po ba ninyong lumipat sa ibang kuwarto?

42. Nagbuwis ng buhay ang ilang bayaning pilipino makamit lang ang araw ng kalayaan.

43. Gusto kong manood ng mga pambatang palabas.

44. Makikiraan po!

45. Magdamagan silang nagtrabaho sa call center.

46. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

47. En mi jardín, cultivo varias hierbas como el tomillo, la albahaca y el perejil.

48. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

49. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

50. The football field is divided into two halves, with each team playing offense and defense alternately.

Recent Searches

nalalaglagmoviesmakakasahodpinapasayaskyinjurymakakakaenhumihingalpakakasalanmagalangnagyayangpagbibirohumihingililipadtataasawitindecisionsbulongkunwaairconnapapikitpakilutobevarepunsokantamrsanimodebatesibalikpedeikinalulungkottrainsgiftnegro-slavesnakararaanpangyayaringlumiitnalugmokdropshipping,langostanakakaanimhulihanallottedumagauniversitykapangyahiranpalibhasainspiresipatillisugaasimprovesumugodevenmuliemailmotionbehindh-hindiobservererkumikinignapakagagandaemocionantekamiasmongyumabangsinusuklalyannerissasiguradotuktokika-12likodbangkangpagbatinapawiadditionallysiguroninyongkalikasanumigibninacadenaannikaeneromalapitanmalamanalaalablusangcornersbitawansteerpasaneasierstudentmakikipag-duetopagpapakilalapodcasts,unibersidadkinatatalungkuangnakaupopagkalungkotpagluluksapinakamaartengnakaliliyongkinauupuangnakalilipaspagkaimpaktopagkakalutomagtanghalianvirksomhedermagpapabunottinatawagngingisi-ngisingmakikipaglarorevolucionadonakakapasoknagpapaigibmarketplacestumatanglawbisitaparehongkalaunanpagtinginpinuntahantumutubokabuntisanpamilihanmaglalaropinahalatapaglisannamumutlailalagayamericanakalockmagsunogyumuyukokumirotnaglahokondisyonpambatanguugod-ugodencuestaskabutihantumunogglobaltumaposmagawasementeryoumangatkaliwakumananpagguhitpinangalananalas-dospoonghinihintaymaasahandiyaryotiempostalinoikatlongincitamenterreorganizingoperativospagongsumasayawadvancementcaracterizacrameindustriyaalagangkailanmanmataaslipatforståmaghahandakasuutanyoutubetsinelasdustpansandalingadecuadoflamencokamotebaguioipinadiliginbunutannanoodisubovegaspalayoeconomicipinambilimaranasanmagtanimnakainpinisilmabigyan