Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "movies"

1. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

2. Brad Pitt is known for his charismatic performances in movies such as "Fight Club" and "Ocean's Eleven."

3. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

4. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

5. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

6. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

7. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

8. Scarlett Johansson is a prominent actress known for her roles in movies like "Lost in Translation" and as Black Widow in the Marvel films.

9. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

10. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

11. They watch movies together on Fridays.

12. Tom Cruise is a highly successful actor known for his roles in movies like "Top Gun" and the "Mission: Impossible" series.

13. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

Random Sentences

1. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

2. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

3. Los héroes son capaces de cambiar el curso de la historia con sus acciones valientes.

4. Ang aking ina ay isang magaling na mananahi.

5. Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

6. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

7. Nagka-cutting classes ako kanina dahil biglaang nagkasakit ako.

8. Hindi ko kayang hindi sabihin sa iyo, sana pwede ba kitang mahalin?

9. Sa bawat pagsubok, si Hidilyn Diaz ay laging naniniwala na ang pagsisikap ay susi sa tagumpay.

10. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

11. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

12. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

13. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

14. Nationalism has played a significant role in many historical events, including the two World Wars.

15. Medarbejdere kan arbejde i forskellige miljøer som kontorer eller fabrikker.

16. Naglipana ang mga turista sa baybayin ngayong tag-init.

17. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

18. If you want to get the best deals at the farmer's market, you have to be the early bird.

19. Bakit ka tumakbo papunta dito?

20. Gusto ko nang kumain, datapwat wala pa akong pera.

21. Magkano ang arkila ng bisikleta?

22. Maaga dumating ang flight namin.

23. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

24. Insider trading and market manipulation are illegal practices that can harm the integrity of the stock market.

25. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

26. Foreclosed properties can be a good option for those who are looking for a vacation home or second property.

27. Paglabas niya ng bahay, nabigla siya nang biglang umambon ng malakas.

28. Ang talento ng mga Pinoy sa pagkanta ay hinahangaan sa buong mundo.

29. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

30. Leukemia can be caused by genetic mutations or exposure to certain chemicals or radiation.

31. Nakita ko sa facebook ang dati kong kaklase.

32. Håbet om at opnå noget kan motivere os til at tage skridt for at nå vores mål.

33. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

34. Hindi sadyang nasaktan siya nang malaman niyang iniwan siya ng kanyang kasintahan.

35. Twinkle, twinkle, little star.

36. Marahan niyang inalis sa pagkakakawit ang mga balde.

37. Nahuli ng guwardiya ang magnanakaw habang ini-inspect ang kanyang bag.

38. Mayroon ka bang kapatid na lalaki?

39. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

40. Hinde mo pa nga pinapatapos yung sasabihin ko eh.

41. Ano ang ginawa mo noong Sabado?

42. Today, Amazon is one of the world's largest online retailers.

43. Sa bata nakatingin ang pulis na wari'y nag-iisip ng dapat gawin.

44. Naman! Alam niyo yung feeling na alam kong siya na talaga?

45. Nanood sina Pedro ng sine kahapon.

46. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

47. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

48. Magalang na hiniling niya ang tulong ng guro sa kanyang takdang aralin.

49. Offering forgiveness doesn't mean we have to continue a relationship with someone who has repeatedly hurt us; setting boundaries is important for self-care.

50. Nilimas ang kanilang kabuhayan at sapilitang dinala sa tabing dagat ang kadalagahang napili.

Recent Searches

gayunmanmoviesstylesevilbukasigigiitcharismaticbatobutterflymagbungakaraokeconstitutiontopicjingjingiyaknakabibingingnobodykanginasirababasahinnalalamannochekabuntisanistasyontinayeksempelmaghaponbowlpintuangubatsuzetteayokonalalaglagmagkamaliperfectpublishing,bumabagtaglagasemocionalpagtiisanputahelastkalayuankoreademocraticpansamantalapaosbinibilangpumupuriyanpatakboibilimakidalosilaytanggalintumigilipatuloysumasambaattentionbotanteanaylakadsinumangnagpatuloywalisinakyatritonageespadahanisinakripisyolikesmaghahandabeganligaliginiangatmatatandamag-anakconsiderarkumaripaspulubirelybigyantalehampaslupasigntiningnanavailablepahahanapmanalosawsawanbobotopagtutolgodtdespuesiniirognglalabaqualitypagpapakilalacurtainspaksanakakapuntanasunogtipcorrectingoverviewpagdudugonutrientesasignaturaquicklypigingumikotcesfigureswindowsiglojunjunpresentmakapagempakebeginningspumuloteheheechavepandidirimagdilimpananakitmiyerkolespanatagbinabatiikinatuwasumarapstrategiesmalayangleadbawianpasinghalcommunitypunsosabogsumibolnagmamaktolpakidalhancantidadanaksasabihinaksidentetaraclockuntimelyhabilidadesusoipinabienumiyakpambatangmindheftybotepalapagpumapaligidlottokababalaghangmaghatinggabisabermini-helicopteripapainitmagbigayantalentpaghihingalonagbiyahediagnosticsakalingzootenidoworkingmagnakawnangangakogratificante,investing:eskuwelabihirangnakumbinsiturismochristmastv-showsgayundinkanikanilangtaxikaninopakaininspeecheshulihanmakalaglag-pantytigasfurbumotocrucialbookslegendsnicoiniresetapinag-usapan