Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "forces"

1. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

2. The value of cryptocurrency can fluctuate rapidly due to market forces.

3. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

Random Sentences

1. En algunos países, el Día de San Valentín se celebra como el Día de la Amistad y el Amor.

2. Payat siya ngunit mahahaba ang kanyang biyas.

3. Los héroes pueden ser encontrados en diferentes campos, como el deporte, la ciencia, el arte o el servicio público.

4. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

5. Les motivations peuvent changer au fil du temps, et il est important de s'adapter à ces changements pour rester motivé.

6. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

7. Pinapakain ng pulotgata ang mga langgam sa aming bakuran.

8. Napatingin ako sa may likod ko.

9. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

10. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

11. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

12. Nag-iingat siya na hindi humalinghing nang malakas dahil baka mahalata ng kanyang kalaban.

13. I have lost my phone again.

14. Ang mga botanista ay nagtatanim ng mga endemikong halaman sa mga pook kagubatan.

15. Teknologi er en vidtstrakt kategori, der dækker over en række forskellige områder, fra elektronik til software til maskiner og transportmidler

16. Sa mga kasal, kadalasan ay mayroong programa ng sayawan upang mas masaya ang pagdiriwang.

17. Los árboles pueden perder sus hojas en invierno, creando un aspecto desnudo y frío.

18. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

19. Bakit hindi nya ako ginising?

20.

21. Las vacaciones de invierno son un momento para descansar y pasar tiempo en familia.

22. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

23. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

24. Kailangan ko gumising nang maaga bukas.

25. Ang pulis ay nakabalik na sa outpost at sa isang ospital na tumatawag.

26. Nakakuha ako ng sagot sa brainly.

27. Ang bata ay takot na nakatingin sa kanya.

28. Nanghahapdi at waring nasusunog ang kanyang balat.

29. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

30. Ang mga opisyal ng barangay ay nag-organisa ng programa kung saan ang mga residente ay maaaring lumibot sa kalsada para sa pagsasanay sa kalusugan.

31. Ang digmaan ay maaaring magdulot ng pagkasira ng mga kultura at tradisyon.

32. We admire the creativity of innovative thinkers and inventors.

33. La música puede ser utilizada para transmitir emociones y mensajes.

34. Me gusta preparar infusiones de hierbas para relajarme.

35. Triggering is a key feature of oscilloscopes, allowing users to stabilize and synchronize waveforms.

36. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

37. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

38. Inirapan ko na lang siya saka tumayo.

39. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

40. Hormonbehandling og kirurgi kan have forskellige risici og bivirkninger, og det er vigtigt for transkønnede personer at konsultere med kvalificerede sundhedspersonale.

41. Dalhan ninyo ng prutas si lola.

42. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

43. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

44. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

45. Inakalang madaling matatapos ang proyekto, ngunit maraming komplikasyon ang dumating.

46. Hinde ko siya pinansin at patuloy lang sa pag kain ko.

47. Les problèmes de santé mentale peuvent avoir des effets physiques et sociaux sur une personne.

48. All these years, I have been working hard to achieve my dreams.

49. Lights the traveler in the dark.

50. Anong oras natatapos ang pulong?

Recent Searches

pasangforcespetsaginisingpyestaspecializedmatindingmonetizingconditioningbeingflyhalikabroadpopulationnaroondecreasebataautomaticandyinaapiedit:negativemangingibigmalayakinahuhumalinganlabanancommercialnakasakitsetnamulatlumilipadkananmatalikisinagotganangumalispakakasalannakakapagtakaamendmentseitherbilingunderholdervariousnagtatamposuriinpaghinginaiinispamagatmakagawatungkolmaalikabokoktubrepabilinakabibingingsipadelegawafacekinagagalakhiningabakantedalawangpapansininbagkusrobinhoodmagselossandalisentimosiligtasnararapatbibiliolivianaglutotasahaygagginangmenossumakitsakeninalalayanpshmansanasmatangrespektivenakabawimaglarosugatangmag-usappaliparinilangipinikitadoptedshetonceditonanghihinamalasutlahinilaexpertnatigilandeteriorateipinambilipinagkaloobanpanatagadvancedideologieshuertosuedeumaagosumilingsakatumalabbosesdreamplatomagkababatanapagtantohumahangospermitennagmahirapapollosiembramarahaspangalankasinamadventeventscompostelamakapangyarihangnagtitiisnakapapasongdadalawinbukodformnailigtaspeaceconectadospwestowritepamumuhaykatawandinukotsisikatnakitamulaakokontinentengjeetsinulidbahaymalakipagdiriwangpinagmamasdanbaharevolutionizednagdaospinabayaanfollowingh-hoyoutlinesgrammarpangkatmaatimmabagalsenadorninyodinanasearnnocherepublicansalatinrightpisaranakataasumiinomnamahiramperyahanpaghalakhaklotkasocardigantinanggalbutiidiomajenyeuphoricneanaglaonsalitanginihandabilhinsabonginteractkasingindiapalay