Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "increase"

1. Eating a balanced diet can increase energy levels and improve mood.

2. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

3. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

4. Not only that; but as the population of the world increases, the need for energy will also increase

5. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

6. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

7. The company's financial statement showed an increase in acquired assets.

8. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

9. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

10. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

11. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Dumating ang mga atleta sa entablado nang limahan.

2. Promise yan ha? naramdaman ko yung pag tango niya

3. Sa bawat pagsubok, si Hidilyn Diaz ay laging naniniwala na ang pagsisikap ay susi sa tagumpay.

4. Nagsusulat ako ng mga pangaral at talumpati para sa mga okasyon sa paaralan.

5. Lumiwanag ang silangan sa pagsikat ng araw.

6. Mabait na mabait ang nanay niya.

7. Takot, nanginginig ang kanyang mga daliri.

8. Gusto kong mamasyal sa Manila zoo.

9. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

10. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

11. Close kasi kayo ni Lory. ngumiti sya na sobrang saya.

12. Magdoorbell ka na.

13. Dwyane Wade was a key player in the Miami Heat's championship runs and known for his clutch performances.

14. Namnamin mo ang halik ng malamig na hangin sa umaga.

15. Bilang paglilinaw, hindi ako nagbigay ng pahintulot sa pagbabago ng plano.

16. When in Rome, do as the Romans do.

17. Haha! Who would care? I'm hiding behind my mask.

18. Ilang beses ka nang sumakay ng eroplano?

19. Les personnes âgées peuvent avoir des problèmes de sommeil en raison de la douleur et de l'inconfort.

20. Jeg har opnået stor erfaring gennem mit arbejde med at lede projekter.

21. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

22. I accidentally let the cat out of the bag about my friend's crush on someone in our group.

23. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

24. Mahalaga na magkaroon tayo ng mga pangarap upang maabot natin ang ating mga layunin.

25. Nagsusulat ako ng aking journal tuwing gabi.

26. Ang nagtutulungan, nagtatagumpay.

27. Naglaro ako ng soccer noong Oktubre.

28. Ano ang binibili ni Consuelo?

29. Musk has faced controversy over his management style and behavior on social media.

30. Los héroes pueden ser encontrados en diferentes campos, como el deporte, la ciencia, el arte o el servicio público.

31. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

32. Drømme kan være en kilde til trøst og håb i svære tider.

33. Pagdukwang niya ay tuloy-tuloy siyang nahulog sa ilog.

34. L'intelligence artificielle peut aider à la conception de médicaments plus efficaces.

35. A lot of birds were chirping in the trees, signaling the start of spring.

36. Sa dakong huli ng kanyang buhay, naging mapayapa na rin ang kanyang pagpanaw.

37. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

38. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

39. Maarte siya sa mga lugar na pupuntahan kaya hindi siya nakikipagsiksikan sa mga madaming tao.

40. I've been driving on this road for an hour, and so far so good.

41. In Spanish cuisine, a tortilla española is a thick omelette made with potatoes and onions.

42. Naputol yung sentence ko kasi bigla niya akong kiniss.

43. Sa ilalim ng lumang kahoy, natagpuan namin ang malamig na lilim na nagbibigay ng kapahingahan sa aming paglalakbay.

44. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

45. Berbagai lembaga dan organisasi keagamaan berperan aktif dalam memberikan pelayanan sosial, pendidikan, dan bantuan kemanusiaan bagi masyarakat Indonesia.

46. Madalas na naglulusak sa dumi ang mga bakuran.

47. Si Hidilyn Diaz ay nagtayo ng weightlifting gym upang suportahan ang mga susunod na henerasyon ng atletang Pilipino.

48. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

49. Napatigil ako sa pagtawa ng seryoso nyang sinabi yun, Eh?

50. Ang magnanakaw ay nakunan ng CCTV habang papalapit ito sa tindahan.

Similar Words

increasesincreased

Recent Searches

increasenutsmaratingextrahulupinag-usapangulatpasaherouncheckedgagawinmahinogkanayangmansanasnanunuksopatakbonakilalamanghikayatfloornasagutanimportantegodtelectionspakibigayshoesbulaklakrangelimitedindividualssyangkinalalagyansuffersoundrestawrannewsgaghawlamangingisdangmentallagingpagkamulatrail18thsumakitperlaglobalschoolsspongebobnagbakasyonmoneyberegningerbowlpangangatawanmakapagempakeuulaminmagtakakumantadipangtinderamassestrenutilizasarabritishisamacapacidadkaugnayanaleharmfuldrewfuncionesinaloklineprimerospaghuhugasdisfrutartumirahimihiyawadvertising,reviewersspiritualpagkalungkothandaantitakakataposkatuwaandadalawinerlindadamingcultivapaglalaitalas-diyesmakakawawapamamasyalnagtatampopamburacongressuugud-ugodpagsisisinaiyakmakasilongnagliwanagresulttvstumalabdaangmagkabilangpalamutiindustriyamiyerkulesevolucionadohistoriapabilipasahemantikakatulongmalawakpalayolugawpagdamikainisdisenyotilashoppingmatabangathenapinagsantosnakatinginhinigitexhaustedbasahinmalambingmalumbayharingsaanpostcardmaisbuwanpasangmalabogreenmillionscoaching:legislativecuandoeditorcontrolledbroadcaststoolferrerslavepuntapracticadoadditionallylastinglaki-lakiiniindamatamannagre-reviewbellnapakamisteryosoinferioreshinahaplosinventionillegalnagpasaniguhitsuotbobmartiantoretedispositivoarturodawnananaginipnagpaiyakforminvesttitigilmakakabalikfiverrnaturalmakulitpinatiraumagamaasahanmagamotmanilbihanmasyadonglondonpagtawanalugmoknaibibigaybusinessesisasabadmaliksiplatformandroidbackflash