Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "sets"

1. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

2. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

3. The sun sets in the evening.

Random Sentences

1. Ngayon ka lang makakakaen dito?

2. Halos dalawang linggong nag quarantine ang pamilya ni Josie matapos mag positibo sa covid.

3. Limitations can be overcome through perseverance, determination, and resourcefulness.

4. Nakatanggap ako ng inspirasyon sa mga kanta ng Bukas Palad sa panahon ng pandemya.

5. El invierno comienza el 21 de diciembre en el hemisferio norte y el 21 de junio en el hemisferio sur.

6. Einstein was known for his sense of humor and his love of sailing.

7. Marahil ay hindi mo muna dapat gamitin ang pera mo sa pagbili ng bagong gadget.

8. Pero sa isang kondisyon, kailangang bayaran mo.

9. Hindi matanggap na malisan sa kanyang iniibig ay mahigpit nyang hinawakan ang kamay ng prinsipe.

10. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

11. The team's performance was absolutely outstanding.

12. Han blev forelsket ved første øjekast. (He fell in love at first sight.)

13. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa pag-iisip, emosyon, at pisikal na kalusugan ng isang tao.

14. Anong gamot ang inireseta ng doktor?

15. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

16. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

17. Ang pagiging malilimutin ni Leah ay dala ng labis na pagkaabala sa trabaho.

18. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

19. He used credit from the bank to start his own business.

20. Huwag kang lalayo nang palayo sa amin para hindi ka mawala.

21. Det er også vigtigt at spise en sund og afbalanceret kost for at støtte ens træningsmål og sundhed generelt.

22. Hindi ako sang-ayon sa pagtrato ng ibang mga tao sa kanilang mga kapwa.

23. Tinuro ng aking lola kung paano magluto ng suman gamit ang pulotgata.

24. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

25. Ang pagdidilim ng kalangitan ay nagpakalma sa init ng araw at nagbigay daan sa isang magandang sunset.

26. Pinuri umano ng mga eksperto ang bagong teknolohiyang inilunsad ng mga siyentipiko.

27. "You can't teach an old dog new tricks."

28. Sa droga, walang kasiguraduhan kundi kamatayan.

29. El estudiante con el peinado raro está llamando la atención de sus compañeros.

30. Their primary responsibility is to voice the opinions and needs of their constituents.

31. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

32. The United States also has a system of governors, who are elected to lead each individual state

33. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

34. Maraming mga anak-pawis ang hindi makatugon sa kanilang mga pangangailangan dahil sa kakulangan ng oportunidad.

35. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

36. Los sueños son el motor que nos impulsa a lograr nuestras metas. (Dreams are the engine that drives us to achieve our goals.)

37. The sun sets in the evening.

38. Wala akong pakelam, basta nasa ref ng bahay ko akin!

39. Makinig ka na lang.

40. Ang sugal ay maaaring magdulot ng labis na stress, pagkabalisa, at pagkabahala sa mga manlalaro.

41. Pull yourself together and focus on the task at hand.

42. Hindi tayo sigurado/nakatitiyak.

43. Isinilang si Apolinario Mabini noong ika-23 ng Hulyo, 1864.

44. Mathematics is an ever-evolving field with new discoveries and applications being made constantly.

45. They organized a marathon, with all proceeds going to charitable causes.

46. Television has also had an impact on education

47. Ano ang ginawa mo noong Sabado?

48. Denne kombination har vist sig at være meget effektiv i at skabe en høj grad af velstand og velfærd for befolkningen

49. They are not cooking together tonight.

50. Ang taong nagigipit, sa patalim kumakapit.

Recent Searches

setsthingsambitrimasnatalohanapintagumpaychristmaslandasuwakpagbatixviiharmfulfistsheilabingdontcompartenpayfurycafeteriahinawakanpaglayashinukaysementeryonapastorekapekagandahagnaliwanagantinanggapbigongskyldesmagkaharapbehindencuestasyungdibanakakaanimikatlongsakyanleftinteligenteseclipxenakatingingibinibigayshocksagingnaglipanangsinagottresmariepaggawapalengkefaktorer,nagdalabeyonddaysnaglalarostandmarunonglumingoneksenanaglalakadforevermaubosotherstawasirasiggoodencounterauditmarchshowcebunakangisingtagpianglagnatgawainnakaakyatseenfourreleasedpopulationofferfaultplantasnasabingpitomangingisdablusangmakaratinglendinghabilidadesbiologinagpepeketumahimikt-shirtmagpaliwanagmemoryconvertingshiftroughinaapielectsino-sinonakabluecountrynagbentamagamotnagsinesacrificekabuhayanmatitigasalaksumisilipcommercenagcurvekubyertosnawalangkaano-anoatensyongmedicalhayaangpalancamahinogpinakidalapumitastemperaturaapatnapunangyarinaiilangkwenta-kwentakagalakantenerobserverertinulak-tulaksalu-salofuncionar3hrsbiyernesmanalolalimbantulotfollowinghawlataksigovernorstandangpasensyasoundanihinlimitedmalikotpamamahingasignalsigntwo-partydinanasgagstosumasambapagebatosearchsiyaclasesnagliliyabmakuhamakikiligokulotkastilanggarciamagulayawnakauwieksempelnapatingalamaestroisinulatpinagbigyanconbilihinbarongmagsugaltradisyonbalinganmukamagpuntaso-callednagreplyspeeddireksyonfulfillmentmatagumpaytienennaguusappaglingonlever,tinatanong