Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "magbabagsik"

1. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

Random Sentences

1. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

2. I've been using this new software, and so far so good.

3. El uso de drogas es un problema grave en muchas sociedades.

4. La science des matériaux permet de développer de nouveaux matériaux pour de multiples applications.

5. He cooks dinner for his family.

6. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

7. You can't judge a book by its cover.

8. Nandiyan po ba si Ginang de la Cruz?

9. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

10. The model on the runway was a beautiful lady who effortlessly commanded attention.

11. Pedro at Juan ang mga pangalan ninyo.

12. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

13. Patuloy pa rin ang paghalik ng butiki sa lupa tuwing dapit-hapon.

14. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

15. Ang buhangin sa tabing-dagat ay nagbabaga sa init ng araw kaya’t mahirap itong apakan.

16. Bilang paglilinaw, ang ating proyekto ay hindi pa tapos kaya hindi pa ito maaaring ipasa.

17. Gusto ko ang mga bahaging puno ng aksiyon.

18. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

19. It ain't over till the fat lady sings

20. The traffic on social media posts spiked after the news went viral.

21. Mag-iikasiyam na nang dumating siya sa pamilihan.

22. Gaano ka kadalas uminom ng bitamina?

23. El nacimiento de un bebé puede tener un gran impacto en la vida de los padres y la familia, y puede requerir ajustes en la rutina diaria y las responsabilidades.

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. The business started to gain momentum after a successful marketing campaign.

26. Higupin mo nang dahan-dahan para hindi ka mabulunan.

27. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

28. Mathematics is the study of numbers, quantities, and shapes.

29. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

30. Mayroong nakawan sa bahay namin kahapon, pero aksidente namin naabutan ang mga magnanakaw.

31. Uanset ens religiøse overbevisning er påsken en tid til at fejre håbet om nyt liv og genfødsel.

32. Los héroes están dispuestos a enfrentar los desafíos y luchar por lo que creen.

33. Stock market investing carries risks and requires careful research and analysis.

34. I always feel grateful for another year of life on my birthday.

35. Come on, spill the beans! What did you find out?

36. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

37. Anong kailangan mo? pabalang kong tanong.

38. Pinakain ni Fia ang aso ng dog treats.

39. Nagbabaga ang usapan ng mga opisyal sa harap ng media dahil sa kontrobersiya.

40. You need to pull yourself together and face the reality of the situation.

41. Les personnes âgées peuvent avoir des relations affectives et intimes avec leur partenaire.

42. Ang aking kabiyak ay ang aking pinakamatalik na kaibigan at tagapagtanggol.

43. Sa bawat Chinese New Year, ang mga tao ay nagbibigay ng mga bagong larawan at dekorasyon upang ipagdiwang ang bagong panimula.

44. Nanalo siya ng award noong 2001.

45. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

46. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

47. Nanlalamig, nanginginig na ako.

48. Nareklamo ko na ho ito pero wala hong sagot.

49. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

50. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

Recent Searches

cultivanagkwentonamumulotmagbabagsikmakikipagsayawprincipalescualquierumagawkilongfactoresnapuyatyouthpagkagisingcancerkanikanilangpinasalamatantungawnagpakunotmagkaibangnagtalagainvesting:nareklamogalawnaghubadownyumuyukominerviekontratakumalmakabighatitabisitakwartoinaaminkapaligiranpinangaralanpalasyoyourafternoonminatamistig-bebeinteiiwasannaglaonmaghaponvelfungerendeginawaranpalakaulosinisitraditionalsyanitolalimagosmaynilakalabanattorneykuligligpigilansakalingbigyansineandoymalasutlakusinaboyfriendbiyernesellaconectandatiunangmabigyanthreepinalambotclassroomlupainmaaringislalilymanghulicesumulankarapatanshepamahalaantibigtatlooutlineagilanaglalababillhighroqueipapainitknowsmedikalmalakiemaildinanasshadeseasierknowartsimageshubad-baromauntogpangakoninamaramotkinalimutanomfattendebaguiowonderannikaanilacompletamentemaisipmaalwanglipat1960sinintayganangparoroonaelectoralriyaninvitationlistahanayawochandotagalogwashingtonhinigitapoybuenarealwordsbugtongbroughtharingwidespreadsinipangisugabandadarkmagdilimhallsorry18thipinabaliktenmajorisiphangaringlosssupremecomunicanamerikamerrydiagnosticstrategybellsumalipasandontyearfuncionartransitbelievednilutomonetizingcableconsiderartipidkumatoksolidifymitigatemanagerlasinggalitrequirepeksmanprogrammingtrinasumasayawkaninumankabiyakkesotibokmakasalanangpagsidlanberegningertilgangpagtutolpumiliiniuwibulaklakpinagawapadalassalbahengundas