Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "lot"

1. A lot of birds were chirping in the trees, signaling the start of spring.

2. A lot of laughter and joy filled the room during the family reunion.

3. A lot of money was donated to the charity, making a significant impact.

4. A lot of noise from the construction site disturbed our peace and quiet.

5. A lot of people volunteer their time and resources to help those in need.

6. A lot of rain caused flooding in the streets.

7. A lot of snow fell overnight, making the roads slippery.

8. A lot of time and effort went into planning the party.

9. A lot of traffic on the highway delayed our trip.

10. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

11. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

12. Estoy sudando mucho. (I'm sweating a lot.)

13. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

14. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

15. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

16. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

17. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

18. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

19. I received a lot of gifts on my birthday.

20. I received a lot of happy birthday messages on social media, which made me feel loved.

21. I'm going through a lot of stress at work, but I'm just trying to hang in there.

22. Magkita tayo sa parking lot ng Luneta Park.

23. She has made a lot of progress.

24. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

25. The company lost a lot of money by cutting corners on product quality.

26. The website has a lot of useful information for people interested in learning about history.

27. There are a lot of amazing destinations to explore around the world.

28. There are a lot of benefits to exercising regularly.

29. There are a lot of books on the shelf that I want to read.

30. There are a lot of opportunities to learn and grow in life.

31. There are a lot of reasons why I love living in this city.

32. There were a lot of boxes to unpack after the move.

33. There were a lot of flowers in the garden, creating a beautiful display of colors.

34. There were a lot of options on the menu, making it hard to decide what to order.

35. There were a lot of people at the concert last night.

36. There were a lot of toys scattered around the room.

37. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

38. We have a lot of work to do before the deadline.

39. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

40. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Wala akong maisip, ikaw na magisip ng topic!

2. He bought a series of books by his favorite author, eagerly reading each one.

3. Les enseignants sont formés pour répondre aux besoins individuels des étudiants.

4. Hindi dapat natin balewalain ang mga banta ng kalamidad, datapapwat ay hindi naman ito sigurado na magaganap.

5. Nakalimutan kong magdala ng lapis sa silid-aralan kaya nagpahiram ako sa aking kaibigan.

6. Si mommy ay matapang.

7. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

8. Ang mga bata ay natutong maging responsable sa pamamagitan ng pagsasagawa ng gawaing nagiigib ng tubig sa halamanan.

9. Bago lumaban sa kompetisyon, sinisigurado niyang isagawa ang kanyang ritwal ng pagmumuni-muni upang mapanatag ang sarili.

10. Nag-aabang ang mga kabataan sa kalsada habang nagiigib ng balde-balde ng tubig para sa kanilang water balloon fight.

11. Nagalit ang matanda at pinalayas ang babaeng madungis.

12. They knew it was risky to trust a stranger with their secrets.

13. Eine gute Gewissensentscheidung zu treffen, erfordert oft Mut und Entschlossenheit.

14. Madalas na nagiging dahilan ng utang ang kawalan ng sapat na pera upang matugunan ang mga pangangailangan.

15. With the Miami Heat, LeBron formed a formidable trio known as the "Big Three" alongside Dwyane Wade and Chris Bosh.

16. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman, kaya't ito ay mahalaga sa buhay ng mga tao.

17. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

18. No puedo comer comida picante, me irrita el estómago.

19. Naku, may boyfriend ako eh. sabi ko.

20. ¿Cuándo es tu cumpleaños?

21. La paciencia nos ayuda a controlar nuestras emociones.

22. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

23. Palibhasa ay madalas na nagkakaroon ng mga insights sa mga bagay na hindi pa naiisip ng ibang mga tao.

24. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

25. The sun does not rise in the west.

26. Buksan ang puso at isipan.

27. Ang pagtulog ay isang mahusay na paraan upang makalimutan pansamantala ang mga alalahanin at stress.

28. Ang pagmamalabis sa pag-inom ng alak ay maaaring magdulot ng mga problemang pangkalusugan at personal.

29. Pasasaan ba't di iikli ang pila? naisip niya.

30. Ang mabuting kaibigan, ay higit pa sa kayamanan.

31. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

32. Sa bawat kumpetisyon, ipinapakita ni Carlos Yulo ang kahusayan at disiplina ng isang atletang Pilipino.

33. He does not break traffic rules.

34. Bayaan mo na nga sila.

35. The momentum of the economy slowed down due to a global recession.

36. Kumusta? Ako si Pedro Santos.

37. Los héroes son personas valientes y audaces que se destacan por su coraje y determinación.

38. In some cuisines, omelettes are served as a light lunch or dinner with a side salad.

39. Lügen haben kurze Beine.

40. Mencapai tujuan dan meraih kesuksesan dapat memberikan perasaan kebahagiaan yang mendalam.

41. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao, at ito ay isang paraan ng pag-awit ng kanilang mga kuwento.

42. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

43. Adequate fiber intake can help regulate the digestive system and maintain gut health.

44. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

45. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

46. Bibisita ako sa lola ko sa Mayo.

47. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

48. The company's growth strategy is focused on acquiring more assets.

49. Ang saya ng Pinoy fiesta, lalo na kapag may parada at sayawan.

50. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

Similar Words

Ipinabalotlottonag-pilotokulotdulotnababalotBantulotbalotPumulotbumabalotmamulotnamumulotNabalotallottedlot,

Recent Searches

boklotpresidentekaninanangahassakabakapondokaniyapleasedatatravelmasayangnilolokonaninirahanmakikikaintinakasanisamaditoanthonypasinghalanimales,kahaponelectionsmakapangyarihangeyaipinadakipmangyaripahingalsipahumalakhakmerchandiseoutposterhanapinmalilimutindalamalusoganidatimakapagsabimabutipunsookayhinilanagbibigaymusiciansmatandaalas-doskapatidbotantetarangkahanafteragesitaasbagkuskristomahiwagagumawabilangearningprobinsyarepresentativecarriedinterestshimigpwedepagsasayamagkaroonnakakatakotbotewastobenefitspalagayregalocellphonekaragatanmarahiltactobalitangrelybanaliwanisinulatourpag-aanilungkotdadalhinduontrapikednasilakainitanmagkasamakinatatakutanminsanalinnagbiyayaapologeticfriedahan-dahanmapaibabawpayatpumansindilagumagawparusabeingitssenadormabiroseryosongtsinabilanggoinaasahangcouldkapaligiranmagpapaligoyligoycreatividadmahahabatag-arawkotsengpasukani-markpinag-aralannagtatanimkaliwangburgerunatatayumaapawtagumpayfidelbuongmalalimpawiinlinggodinalasinungalingiiyakpagkababalugawpowerpapasokmasaksihannaglahosurveysmagpahingatilskrivesbawiankendiresumenmemomag-usapbadingmagsusuottaomakikiligoumanosumusulatgamotkablansiguradogumuglongparkumokaylarongupanglalakengakinasahanbotomagulangdarkpamagathinigitpinangaralannakatitigstreetpangungutyamansanasstatekumakapitnag-asaranpalipat-lipatdamingilawilongdisenyotipnakalipassaan-saantenergarbansossiyudadpicstinitirhanpinipisilibonpinagbigyan