Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "lot"

1. A lot of birds were chirping in the trees, signaling the start of spring.

2. A lot of laughter and joy filled the room during the family reunion.

3. A lot of money was donated to the charity, making a significant impact.

4. A lot of noise from the construction site disturbed our peace and quiet.

5. A lot of people volunteer their time and resources to help those in need.

6. A lot of rain caused flooding in the streets.

7. A lot of snow fell overnight, making the roads slippery.

8. A lot of time and effort went into planning the party.

9. A lot of traffic on the highway delayed our trip.

10. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

11. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

12. Estoy sudando mucho. (I'm sweating a lot.)

13. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

14. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

15. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

16. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

17. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

18. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

19. I received a lot of gifts on my birthday.

20. I received a lot of happy birthday messages on social media, which made me feel loved.

21. I'm going through a lot of stress at work, but I'm just trying to hang in there.

22. Magkita tayo sa parking lot ng Luneta Park.

23. She has made a lot of progress.

24. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

25. The company lost a lot of money by cutting corners on product quality.

26. The website has a lot of useful information for people interested in learning about history.

27. There are a lot of amazing destinations to explore around the world.

28. There are a lot of benefits to exercising regularly.

29. There are a lot of books on the shelf that I want to read.

30. There are a lot of opportunities to learn and grow in life.

31. There are a lot of reasons why I love living in this city.

32. There were a lot of boxes to unpack after the move.

33. There were a lot of flowers in the garden, creating a beautiful display of colors.

34. There were a lot of options on the menu, making it hard to decide what to order.

35. There were a lot of people at the concert last night.

36. There were a lot of toys scattered around the room.

37. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

38. We have a lot of work to do before the deadline.

39. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

40. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Dedication is the driving force behind artists who spend countless hours honing their craft.

2. La conciencia nos ayuda a ser responsables de nuestras acciones y decisiones.

3. Ang buntot ng saranggola ay mahaba at makulay.

4. Les personnes âgées peuvent souffrir de solitude et de dépression en raison de l'isolement social.

5. Storm can control the weather, summoning lightning and creating powerful storms.

6. Sayang, aku sedang sibuk sekarang. (Darling, I'm busy right now.)

7. Ang pagtulong sa iba o pagbibigay ng serbisyo ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

8. Sa aming pagtitipon, nagkaroon ng palaro at paligsahan na nagpapakita ng diwa ng bayanihan.

9. Les crises financières peuvent avoir des répercussions importantes sur l'économie mondiale.

10. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

11. Los Angeles, California, is the largest city on the West Coast of the United States.

12. Walang tutulong sa iyo kundi ang iyong pamilya.

13. Minsan, ang pag-iisa ay maaaring maging magandang oportunidad para mag-isip at magpahinga.

14. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

15. He is typing on his computer.

16. Dahil sa iyong pagiging labis na madamot, kahit na marami ka namang pananim na maaring ibahagi sa iyong kapwa, ikaw ay aking paparusahan.

17. May sapot pa ng gagamba sa kanilang kisame.

18. Pinagsisihan niya ang mga salitang hinugot niya mula sa kanyang galit.

19. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

20. Los recién nacidos son pequeños y frágiles, pero llenan nuestros corazones de amor.

21. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

22. Ang mga guro ng musika nagsisilbi upang maipakita ang ganda ng musika sa kanilang mga estudyante.

23. My friend was better off not knowing about her boyfriend's infidelity - ignorance is bliss, or so they say.

24. Aba oo, yun lang pala, nakakunot-noong sagot ni Kablan.

25. El agua es el recurso más preciado y debemos conservarlo.

26. Ikaw na nga lang, hindi pa ako nagugutom eh.

27. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

28. Ang aking Maestra ay napakabait.

29. Pinaniniwalaang ang albularyo ay may kaalaman sa lihim na karunungan ng kagubatan.

30. Ngunit hindi inaasahang ang dadalaw pala sa kanya ay ang kanyang ama

31. Ok lang.. iintayin na lang kita.

32. Ang rebolusyon ay bunga ng pagkamulat ng mga Pilipino kontra kastila.

33. Sa Calamba, Laguna ipinanganak ang pambansang bayani na si Jose Rizal.

34. Sa panghihiyang ginawa ni Kablan, gumanti ang pobreng matanda.

35. I know I'm late, but better late than never, right?

36. He does not watch television.

37. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

38. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

39. Ang pagbabago ng pananaw at pag-iisip ay maaaring magdulot ng pagbabago sa pangamba.

40. Nag-aalala ako dahil biglaan siyang umalis nang walang abiso.

41. Tu peux me passer le sel, s'il te plaît?

42. Pangkaraniwang Araw sa Buhay ng Isang Tao

43. Ang kanilang kaharian ay malapit sa isang maliit na gubat na kung saan ay malayang nakakapamasyal ang mayuming kagandahan.

44. Hang in there and stay focused - we're almost done.

45. Fødslen er en af ​​de mest transformative oplevelser i livet.

46. The medication helped to lower her high blood pressure and prevent complications.

47. Ano ang ipinabalik mo sa waiter?

48. Ang doktor ay pinagpalaluan ng kanyang mga pasyente dahil sa kanyang husay sa pagpapagaling.

49. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

50. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

Similar Words

Ipinabalotlottonag-pilotokulotdulotnababalotBantulotbalotPumulotbumabalotmamulotnamumulotNabalotallottedlot,

Recent Searches

lotmarketplacesdedication,fionaplacesameharapburdenmaximizingrememberedtrinacivilizationrevolucionadobitawanpamahalaannanlilimahidwouldprogresslikelymagsusunuranmakakatakasnanlilisikpinakamagalingmanggagalingpalancapatidiretsahangbringingmakikiligonapagtantogandahanikukumparabiyernespaghusayannagtalagakuryentekubyertosbowlpaglalabamakapagempakebyggetmarangallumiitipinambilipauwinagplayarturoabonoomgkutsilyocontent,yourself,doktorloansnyosurgerysincenamebumugatransitshapingwishinggreenintroducesinabigenerationerdinimakapilingprogramming,attacksequeinitsyncthirdmemorysettingyeahscaleallowsservicesfencingthoughtsbighanihinoglobbycorporationpalayanlabananhudyatsumasakithila-agawanlasingeronabiawangadoptedpinagkasundoebidensyaoutlinemasayahindumibilhindomingosilid-aralannatuyomalulungkotkumakainmaglalakadnagtitindamakauuwimagsalitapunongkahoymagnakawnagtutulunganmagbagong-anyonapatungoglobalpiernapatawagmagasawangpulang-pulaespecializadasnag-iinompinagalitannagtatampopaglalayagnagmakaawakinagagalaktaga-nayonbangladeshnabalitaannalalaglagnaglalarokapatawaranalbularyomamanhikanalikabukinnasasakupanerhvervslivetlumiwanagt-shirtnagpipiknikkagalakannagpaiyaknaglipanangnapakahusaypag-indakmakikitulogricapakakatandaanleaderstaga-hiroshimanagsagawamakatarungangbloggers,nangahasnakakarinigkumaliwamaliksimakipag-barkadadadalawinugatumiiyaknapapadaansusunodimikpantaloniniresetanagpasamasukatinsarilinakarinigbalikatnakangisingsinehantagpiangalaganggovernorspalasyopagbigyanumiimikpuntahanpeksmanmagdaraosdispositivomagpasalamatnapasubsobtaglagasilalagaykisssalbahengmakabawikolehiyolansangankarunungankumananpakakasalannanangise-bookskaliwamasaktanmagsungit