Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "lot"

1. A lot of birds were chirping in the trees, signaling the start of spring.

2. A lot of laughter and joy filled the room during the family reunion.

3. A lot of money was donated to the charity, making a significant impact.

4. A lot of noise from the construction site disturbed our peace and quiet.

5. A lot of people volunteer their time and resources to help those in need.

6. A lot of rain caused flooding in the streets.

7. A lot of snow fell overnight, making the roads slippery.

8. A lot of time and effort went into planning the party.

9. A lot of traffic on the highway delayed our trip.

10. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

11. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

12. Estoy sudando mucho. (I'm sweating a lot.)

13. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

14. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

15. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

16. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

17. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

18. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

19. I received a lot of gifts on my birthday.

20. I received a lot of happy birthday messages on social media, which made me feel loved.

21. I'm going through a lot of stress at work, but I'm just trying to hang in there.

22. Magkita tayo sa parking lot ng Luneta Park.

23. She has made a lot of progress.

24. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

25. The company lost a lot of money by cutting corners on product quality.

26. The website has a lot of useful information for people interested in learning about history.

27. There are a lot of amazing destinations to explore around the world.

28. There are a lot of benefits to exercising regularly.

29. There are a lot of books on the shelf that I want to read.

30. There are a lot of opportunities to learn and grow in life.

31. There are a lot of reasons why I love living in this city.

32. There were a lot of boxes to unpack after the move.

33. There were a lot of flowers in the garden, creating a beautiful display of colors.

34. There were a lot of options on the menu, making it hard to decide what to order.

35. There were a lot of people at the concert last night.

36. There were a lot of toys scattered around the room.

37. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

38. We have a lot of work to do before the deadline.

39. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

40. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Dahil sa sobrang init, naglipana ang mga puting ulap sa kalangitan.

2. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

3. Sinuman sa kaharian ay walang makapagbigay ng lunas.

4. Les étudiants doivent respecter les règles de conduite à l'école.

5. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

6. Ang kalayaan ay hindi lamang tungkol sa pagiging malaya sa pagpapahayag ng ating mga saloobin, ito rin ay tungkol sa pagpili ng ating mga sariling desisyon at pagpapasya sa ating buhay.

7. Pagkuwa'y bigla na lamang nitong kakayurin ng hintuturo ang balat sa kanyang batok.

8. Ito na yata ang pinakamatabang babae na nakilala niya.

9.

10. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

11. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

12. Sa panahon ng tag-ulan, naglipana ang mga lamok sa amin.

13. Nakita nilang ang balat ng bunga ay manipis at maliit ang buto.

14. Namnamin mo ang ganda ng paligid sa takipsilim.

15. Ayaw kong pag-isipan ang sinabi mo.

16. Takot siyang salatin ang sahig dahil sa maaaring may ipis.

17. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

18. Tulala siyang tumitig sa malawak na tanawin ng dagat.

19. Ang mahal naman ng laptop na binili ni Andy.

20. Nagkakasya rin ang pamilya na mamulot ng mga tirang pagkain na maaari pang pakinabangan.

21. Namangha ang lahat nang magdilim ang langit at gumuhit ang matalim na kidlat.

22. Sa Pilipinas, ang tag-ulan ay kadalasang nagsisimula mula Hunyo hanggang Nobyembre.

23. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

24. Nanatili siya sa isang mataas na puno at nagmasid-masid ulit muna ito at inantay kung sino ang mukhang nananalo.

25. Una mala conciencia puede llevarnos a tomar malas decisiones.

26. Los héroes pueden ser aquellos que defienden los derechos humanos y luchan contra la opresión.

27. Dahil sa maling pagdisiplina, naglipana ang mga pangit na gawi sa lipunan.

28. Pinangunahan ni Emilio Aguinaldo ang proklamasyon ng kasarinlan ng Pilipinas noong Hunyo 12, 1898.

29. Payat siya ngunit mahahaba ang kanyang biyas.

30. Ilang gabi pa nga lang.

31. Portion control is important for maintaining a healthy diet.

32. Gawan ninyo ng paraang makalabas po sana ako sa pagkakakulong ko sa loob ng prutas na ito.

33. Dapat magkaroon ng sapat na proteksyon at benepisyo ang mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

34. Kahit na magkaiba kami ng wika, naging magkaibigan pa rin kami dahil sa aming kaulayaw sa isa't isa.

35. Ibinili ko ng libro si Juan.

36. May problema ka sa oras? Kung gayon, subukan mong gumawa ng iskedyul.

37. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

38. Kapag mayroong sira sa ngipin, kailangan ng agarang aksyon upang hindi lumala pa ang problema.

39. Madami talagang pulitiko ang kurakot.

40. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

41. Good things come to those who wait.

42. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

43. Nagliwanag ang buong paligid at naging abo ang katawan ni Matesa.

44. At sa tuwing tataas, hahanapin ako ng tingin sa baba at malungkot nangingitian.

45. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

46. Celles-ci comprennent la thérapie, le conseil et les groupes de soutien.

47. Hirap sa inyo ay sabad kayo nang sabad, e, sabi ng pulis

48. Dapat kong bilhan ng regalo si Maria.

49. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

50. Hindi ho ba madilim sa kalye sa gabi?

Similar Words

Ipinabalotlottonag-pilotokulotdulotnababalotBantulotbalotPumulotbumabalotmamulotnamumulotNabalotallottedlot,

Recent Searches

lotprutaslaroinulitlumipatiiklimbricosisinalangstateslalaunoshangaringsearchfuearghmasinopjanewidespreadsumindibumababadollyjokebisigmemokinabukasanbalecolouripinabaliksuelopasyaplatformsdaddyoverviewsumapitrelevantdraft,tomlightspatrickdependinguloconvertingnagugutomatensyonerlindapumapaligidpaki-bukasgusaliginawangipagmalaakikatolikopalapagjulietmaghatinggabigenerationer18thinuminressourcernepamburapaaralanmakakatakasgisingkumainnananaghilisikre,informationbathalahjempitongtumalonengkantadangpinasalamatanentrancedisfrutarhayaankilongberegningermamahalinpundidopamimilhingkungsitawmag-aaralpamamahingalagunaalaksuriinilangelectionsutilizapumuntamapenforcingneedabonagtatakbonakasakaykulunganbihasasakupingenerategumandaanak-pawistooiskedyulkirotuhognapagtantotatlofoursinunggabanlamanhiponkaagawbasketmarahansinasawacolorkalimutandiyannegro-slavesnauliniganvisualhomeworkloobpatuyosultanpagsasalitanaaksidentemagnanakawbasahinpagkapasokareasimportantpagbubuhatanmakalapitpaghabanasasabihanpalayokakaibangmagpasalamattinatawaggreenhillsydelserkikoparticulartulongdamingtiismagulangwatchnagibigaydiplomatawamgatrabajarpinakamaartengkatotohanansenatenapatigninlolahierbasprusisyonadditionallylumulusobayost-shirtbakantetumitigilkondisyonlumbaylibohanapinarawaraw-araw-arawmainitmangangalakalkalayaannakakalayopinagwikaanutosculturesgreaterreducedreachingpamamalakadpagtayonaglalambingikinakatwiraneffektivttumikimtinanggalrangepinauupahangnamuhaynakabuklatmaghintay