Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "lot"

1. A lot of birds were chirping in the trees, signaling the start of spring.

2. A lot of laughter and joy filled the room during the family reunion.

3. A lot of money was donated to the charity, making a significant impact.

4. A lot of noise from the construction site disturbed our peace and quiet.

5. A lot of people volunteer their time and resources to help those in need.

6. A lot of rain caused flooding in the streets.

7. A lot of snow fell overnight, making the roads slippery.

8. A lot of time and effort went into planning the party.

9. A lot of traffic on the highway delayed our trip.

10. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

11. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

12. Estoy sudando mucho. (I'm sweating a lot.)

13. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

14. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

15. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

16. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

17. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

18. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

19. I received a lot of gifts on my birthday.

20. I received a lot of happy birthday messages on social media, which made me feel loved.

21. I'm going through a lot of stress at work, but I'm just trying to hang in there.

22. Magkita tayo sa parking lot ng Luneta Park.

23. She has made a lot of progress.

24. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

25. The company lost a lot of money by cutting corners on product quality.

26. The website has a lot of useful information for people interested in learning about history.

27. There are a lot of amazing destinations to explore around the world.

28. There are a lot of benefits to exercising regularly.

29. There are a lot of books on the shelf that I want to read.

30. There are a lot of opportunities to learn and grow in life.

31. There are a lot of reasons why I love living in this city.

32. There were a lot of boxes to unpack after the move.

33. There were a lot of flowers in the garden, creating a beautiful display of colors.

34. There were a lot of options on the menu, making it hard to decide what to order.

35. There were a lot of people at the concert last night.

36. There were a lot of toys scattered around the room.

37. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

38. We have a lot of work to do before the deadline.

39. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

40. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Nais naming makita ang mga balyena sa malapit na karagatan.

2. May mga pagkakataon na kinakailangan mong hiramin ang isang sasakyan para sa long-distance travel.

3. Hay muchas formas de arte, como la pintura, la escultura, la danza y la música.

4. Me duele todo el cuerpo. (My whole body hurts.)

5. Las escuelas promueven la inclusión y la diversidad entre los estudiantes.

6. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

7. Sa gitna ng paglalakad sa kalsada, huwag magpabaya sa kaligtasan at sumunod sa mga traffic rules.

8. Ako'y lumilipad at nasa alapaap na.

9. Ang pangamba ay maaaring maging mabuting tagapag-ingat upang maiwasan ang posibleng peligro.

10. Twinkle, twinkle, little star.

11. Sa loob ng aking dibdib, nagliliyab ang poot na pilit kong iniipon.

12. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

13. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

14. Mula noong nakilala kita, hindi ko maalis sa isip ko na crush kita.

15. Ang Datu ay nalungkot at nawalan ng lakas na harapin ang katotohanan.

16. Sa dakong huli, naramdaman ko na wala na akong lakas.

17. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

18. Il existe un certain nombre d'organisations et de programmes qui offrent de l'aide aux personnes luttant contre la dépendance au jeu.

19. Bumili ako ng sarong. Ikaw, saan ka nagpunta?

20. Nakaramdam na lang ako biglang may humampas ng ulo ko.

21. Puwede ho ba akong kumain ng baka at baboy?

22. Ang kanyang presensya sa aming pagtitipon ay lubos naming ikinagagalak.

23. Walaupun Indonesia menghadapi tantangan dalam hal konflik keagamaan, mayoritas penduduk berusaha memelihara keharmonisan dan menghormati perbedaan agama.

24. Anong linya ho ang papuntang Monumento?

25. Omelettes are a popular choice for those following a low-carb or high-protein diet.

26. Wer im Glashaus sitzt, sollte nicht mit Steinen werfen.

27. Oo. Pero kelangan.. susunod ka lang sa akin, ok ba yun?

28. Gusto kong malaman mo na may ganitong pakiramdam ako, kaya sana pwede ba kita ligawan?

29. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

30. Nakatanggap kami ng masamang balita na ang aking kaibigan ay nawala at ito ay lubos naming ikinalulungkot.

31. Ibinenta ni Mang Jose ang karne kay Katie.

32. Wag ka na lang pumunta sa Palawan. aniya.

33. Paglalayag sa malawak na dagat,

34. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

35. Siniyasat ni Sangkalan at ng mga tao ang puno.

36. Good evening! pasigaw pa na salubong sa amin ni Mica.

37. Nasa Massachusetts ang Stoneham.

38. Tengo escalofríos. (I have chills.)

39. Napadungaw siya sa kanyang cellphone at napansin na mayroon siyang mga hindi pa nabasang mensahe.

40. La acuarela es una técnica de pintura que utiliza pigmentos mezclados con agua.

41. Mahal na mahal ni Aling Rosa ang kanyang bugtong na anak.

42. The value of money can fluctuate over time due to factors such as inflation and changes in supply and demand.

43. Mi esposo y yo hemos estado juntos por muchos Días de San Valentín, pero siempre encontramos una manera de hacerlo especial.

44. Hindi kita puwedeng iwan dahil mahal kita.

45. Ang mga kabataan ay naglalaro ng computer games hanggang sa hatinggabi.

46. La literatura japonesa tiene una sutileza sublime que trasciende las barreras culturales.

47. Ngumiti lang siya saken bilang sagot.

48. The amount of knowledge that exists in the world is immeasurable.

49. Cada nacimiento trae consigo la promesa de un futuro lleno de posibilidades.

50. Los agricultores deben estar atentos a las fluctuaciones del mercado y la demanda de sus productos.

Similar Words

Ipinabalotlottonag-pilotokulotdulotnababalotBantulotbalotPumulotbumabalotmamulotnamumulotNabalotallottedlot,

Recent Searches

lotreadinghumihingiumiinomtreatsoffersagabalbefolkningen,choosemagtataposnapakalamigmanipisamangsapagkatblesspanitikan,malamangfull-timenakasimangotkumainkundimangiyak-ngiyaksagapdisenyongmagkapatidlupaindemkumananilanstopearlbobobalatdevelopmakatayopayatpasalamatanlaranganjobpresleymadaliitsnapabalikwashitacourtpwestodogsmay-bahaynapahinganageespadahanalituntuninhappenedbukodinadaliirogborgerenangingisaynakakaenduwendearoundteachersaleiniibigdiyabetisdisappointkinaiinisansorryfleretoysmodernenapakasinungalingsasainsektonglalamunanmanagernaiwangrahamganoonanumangunibersidadumikottanimansarilingelectresultprogramaprobinsyaperpektopawispaulit-ulitparapaitpagkakatumbapagkakataongpagpabiliopoonlinebefolkningenniligawannaninirahannandoonnanakawannalugodnakataasnakaririmarimnagtanghaliannagtagisannagpalalimnagagandahannababasamusmosminamahalmapagkatiwalaanibalikmanunulatmaliksimalabomahiwagamagpapakabaitmagkakailamadamotmaabutanliligawanlibrokuwentokumalaskinantakilalang-kilalakawayankapitbahaykanikanilangkamingkagabikaawayjapanisilangipinikitinyongintindihinibahinanaphamongumagalaw-galawgataseksamendrayberkumikinigdiyosangdingdagokconvertidasbumabagbotobilangguanbateryabarongbahay-bahayanbagyoaksidenteagilaaccessabalangmaasahanjustkatawantumamispaboritoeconomytubig-ulanallebarabasikinakagalitkumidlatnilalatefiawaringkawalannangangambangitinaponproudmaipantawid-gutomrevolutioneretstrategymasayang-masayadedicationabssparkcreatewidenoelwaysaidspendingnagkakamalinaglabahagdananhumabol