Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "adversely"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

Random Sentences

1. Ang tagtuyot ay nagdulot ng krisis sa agrikultura sa buong rehiyon.

2. Eine starke Gewissensentscheidung kann uns helfen, unsere persönlichen Werte und Überzeugungen zu verteidigen.

3. Los héroes defienden la justicia y luchan por los derechos de los demás.

4. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

5. Kahapon, nakita ko siyang tulala sa parke nang walang pakialam sa mga taong nasa paligid niya.

6. Napaiyak si Aling Pising ng makita ang mga tuyong kahoy at posporo sa ilalim ng kanilang bahay.

7. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

8. Don't give up - just hang in there a little longer.

9. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

10. Las hojas de eucalipto se utilizan a menudo para aliviar la congestión nasal.

11. Scissors should be kept sharp to ensure clean and precise cuts.

12. Sa gitna ng pagkabigo, hindi maiwasan ang paglabas ng malalim na himutok.

13. El realismo y el impresionismo son estilos populares en la pintura.

14. Sa anong tela gawa ang T-shirt?

15. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

16. Ang pagpapalinis ng ngipin ay mahalaga para maiwasan ang mga sakit sa bibig.

17. Kebahagiaan bisa ditemukan dalam momen-momen kecil sehari-hari.

18. Sa likod ng kalsada, nagtatago ang magnanakaw na may dala-dalang sako.

19. Napaangat ako ng tingin sa kanya saka tumango.

20. El cultivo de hortalizas es fundamental para una alimentación saludable.

21. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

22. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

23. Sa tuwa ng Elepante ay kumembut-kembot ito sa pag-indak.

24. Mabait ang pamilya ni Aling Juana kaya panatag ang loob ng ama't ina ni Bereti.

25. I do not drink coffee.

26. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

27. "Ang hindi lumingon sa pinanggalingan, hindi makakarating sa paroroonan" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pag-alala at pagpahalaga sa mga pinagmulan.

28. Emphasis can be used to create a memorable and impactful message.

29. Ang daming adik sa aming lugar.

30. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

31. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

32. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

33. No pierdas la paciencia.

34. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

35. Hindi dapat magpakalugi sa pagpapautang dahil ito ay nagdudulot ng financial loss.

36. Nagliliyab ang apoy sa kagubatan, kaya't mabilis na kumalat ang sunog.

37. Nasa silid-tulugan ako at nagitla ako nang biglang bumukas ang bintana sa malakas na hangin.

38. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

39. Kung kulang ka sa calcium, uminom ka ng gatas.

40. Naglabas ako ng malalim na himutok matapos kong matalo sa paligsahan.

41. Hinimas-himas niya yung likod ko pagkalapit niya saken.

42. Les comportements à risque tels que la consommation

43. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

44. Have we missed the deadline?

45. Ang kakahuyan sa paligid ng aming tahanan ay nagbibigay ng kahanga-hangang mga tanawin sa tuwing taglagas.

46. Kapitbahay ni Armael si Juang malilimutin.

47. Walang anuman saad ng mayor.

48. Hinahangad ko na makatapos ng yoga session nang hindi naghihingalo.

49. Gracias por iluminar mi vida con tu presencia.

50. Mange transkønnede personer oplever at blive udsat for chikane, mobning og vold på grund af deres kønsidentitet.

Recent Searches

adverselyrailconvertidasperlasabihingbilaomagkanoatepaacolourbranchesjeromerefersagegrabefeelinginterpretingfaultislaitinuringdoonyonstanddinalaplatformskumain1982graduallysquatteriponghimselftiyaextragatolcontinuedcommunicateuponguiltystoplightdecreaseuloknowledgealignspunong-kahoyteleponotig-bebentenagmadalingmahinogmedisinalihimnagagamitlabinsiyampasyentemangyaripansitdamitjosienatabunanhonestotargetninyongnatanongpalantandaanhawlaalagaiigiblimitedlutuinareassoundhaygaglayasasthmagrinspokerpagdiriwangthoughtssumalichadbangladeshencuestasmanatilimanggagalingbefolkningen,diinvidtstraktnangapatdannami-missikatlongkirbyvedvarendesementeryopongtinitirhanpangalankamag-anakbateryaisipherramientassumasaliwexigentepesoproductsvivanararapatandoypagodisuganakatingingparoimpactsulinganemailgenerationerplagascompartenoueblueimprovementablebehaviorannarelievedhumayobiyernesfullmanghikayatgymnegro-slavesobservereropisinapamagatarbularyosisikatperpektingnagdalakagabipapalapitnabasasongsmaghapongpagsusulitsinungalingsakaymariekulangfulfillingalakangalblusangmorenamedyoasimdiamondhidingsinagotdagasumindisystematiskexamalmacenarkitangmalinissumugodumiilinggoinguminomsummitmuchamag-ibanakalagaymagpaliwanagnaglalakadmakikikainmasayahinfollowing,napakagagandaenviarpambatangpagkasabinovellesrenaiabayaniinagawproducererninaannikamatulunginampliafathertssstawaexperts,reguleringuntimelyenergitoytransmitidasalaala