Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "acceder"

1. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

2. Las personas pobres a menudo enfrentan barreras para acceder a la justicia y la igualdad de oportunidades.

3. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

Random Sentences

1. Hinanap ko ang pulotgata sa bukid upang magkaroon ng panghimagas.

2. By the way, when I say 'minsan' it means every minute.

3. Scientific research has shown that regular exercise can improve heart health.

4. Naniniwala ka ba sa legend ng academy?

5. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

6. Nanalo si Ton Ton bilang presidente ng kanilang paaralan.

7. The company's financial statement showed an increase in acquired assets.

8. Nasaan ang palikuran?

9. Lagi na lamang itong nag fe-facebook.

10. Magandang maganda ang Pilipinas.

11. Puwede ba siyang pumasok sa klase?

12. Hinintay ko siya sa labas ng kanyang opisina upang sabay kaming kumain ng hapunan dahil gustong-gusto ko siyang ligawan.

13. Kailangan nating magsumikap datapapwat marami tayong mga hamon sa buhay.

14. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

15. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

16. Sayang, kapan kita bisa bertemu lagi? (Darling, when can we meet again?)

17. Bigla, mula sa tubig ay isang babae ang lumutang sa hangin.

18. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

19. Oo, malapit na ako.

20. Ayaw ko magtangkang magbiyahe nang walang mapa.

21. The information might be outdated, so take it with a grain of salt and check for more recent sources.

22. Naglipana ang mga isda sa malalim na bahagi ng dagat.

23. Mila Romero ang pangalan ng tiya ko.

24. Landet er en af de mest velstående i verden, og dette kan tilskrives en række faktorer, herunder en høj grad af økonomisk vækst, en velfungerende arbejdsstyrke og en høj grad af offentlig velfærd

25. I am enjoying the beautiful weather.

26. "Wag kang mag-alala" iyon lang ang sagot ng dalaga sa kanya

27. Kung may tiyaga, may nilaga.

28. Magdamagan ang trabaho nila sa call center.

29. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

30. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

31. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

32. Mayroon akong mga alinlangan sa kanilang plano kaya ako ay tumututol dito.

33. Skærtorsdag mindes Jesu sidste nadver med sine disciple, før han blev taget til fange.

34. Eh gaga ka pala eh, gag show mo mukha mo.

35. Sa pagguhit, mahalaga ang pagpapakita ng depth at perspective sa mga larawan para maging realistic ang mga ito.

36. Nakarating ako ng 4th floor at ako pa rin ang pinag uusapan.

37. Når man bliver kvinde, kan man opleve en række fysiske og følelsesmæssige forandringer.

38. Limitations can be overcome through perseverance, determination, and resourcefulness.

39. Ini sangat enak! - This is very delicious!

40. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

41. Los días soleados de invierno pueden ser fríos pero hermosos, con un cielo azul brillante.

42. Ang mensahe ay ibinigay ng isang misteryosong lalake.

43. S-sorry. mahinang sabi ni Mica.

44. Sa harap ng tore, natatanaw ko ang ganda ng arkitektura at kahalagahan ng kasaysayan.

45. Fødslen er en af ​​de mest transformative oplevelser i livet.

46. Det er også vigtigt at spise en sund og afbalanceret kost for at støtte ens træningsmål og sundhed generelt.

47. Mathematical formulas and equations are used to express relationships and patterns.

48. Mataba ang lupang taniman dito.

49. Quien siembra vientos, recoge tempestades.

50. The early bird catches the worm.

Recent Searches

natanggap1000accederespigasabril1787santolagiisaacdolyarbuwalmapaikotprovebookpocapaybipolarsusunduinleukemiaparagraphskaninapaglalabananipipilitluissarilingdonecoinbasetransparentsatisfactiondamitprospermulisuelomensajesmedicalpakakasalansignificantnasundoresourcesuminomlightsartificialfeelingochandochamberslorenapublishinginsteadguidemapspreadreturnedsupportenterpointcommerceiyonakasuotibinigaygreenmabangopaderfurthermahinapinagalitanpatutunguhanpagpapautanggumigisingmagbabagsikkinakabahansugatangpayongnatagalanmerevednagsibiliberkeleytelevisedmag-asawangnakatayounosworkingnagpapaigibminu-minutobintanamarasiganmagandakonsyertokakayananniyogcomputere,gisingmag-plantnamingincludeagaw-buhayallenatigilanlabahinpinoykatibayangnapadpadnabiglaabigaeleasyagapetsangmerry11pmsilbingdiagnosesbutihingsolarreach1920sbukasnagtawanannaglutomakangitinagkasunognakasahodmahawaanmaihaharapnakalagaynasasakupanvirksomhedernamulaklaknakaupopagbabagong-anyopagsasalitananghihinapinakamatabangnagtitindapagpasensyahanbangladeshkinagagalakpagpapatubosalu-salonapipilitanpangyayaribayawakmakasilongiintayinh-hoymakatarungangmakalipasnabubuhayhimigpag-uwipagkapanaloadgangkaklaseibinilipagkaraatumunogbabasahinunattendedi-rechargepagtinginaga-agakuripotpicturespagkaawakanginakaramihanlot,sistemasintensidadginagawapatawarindepartmentumikottrentaisinusuotproducevidtstraktkampeonbinabaanpesopinaulananmaibamagpakaramihumihingisumalakaygalaanminerviemaspartmaidutilizarnaiinitanklasengmagigitinglagunaaddictionwaternilolokoforståmaisipkasama