Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

60 sentences found for "which"

1. A wedding is a ceremony in which two people are united in marriage.

2. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

3. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

4. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

5. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

6. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

7. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

8. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

9. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

10. Electric cars can help reduce air pollution in urban areas, which can have positive impacts on public health.

11. Electric cars have a lower center of gravity, which can improve handling and stability.

12. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

13. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

14. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

15. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

16. Foreclosed properties may have back taxes or other outstanding debts, which the buyer may be responsible for paying.

17. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

18. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

19. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

20. He could not see which way to go

21. He developed the theory of relativity, which revolutionized our understanding of space, time, and gravity.

22. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

23. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

24. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

25. Holy Week begins on Palm Sunday, which marks Jesus' triumphal entry into Jerusalem and the start of the Passion narrative.

26. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

27. I received a lot of happy birthday messages on social media, which made me feel loved.

28. In the early days, telephones were connected to a central switchboard, which connected calls manually

29. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

30. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

31. It is brewed from roasted coffee beans, which come from the Coffea plant.

32. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

33. Lazada has a loyalty program called Lazada Wallet, which allows customers to earn cashback and discounts on purchases.

34. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

35. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

36. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

37. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

38. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

39. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

40. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

41. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

42. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

43. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

44. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

45. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

46. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

47. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

48. The goal of investing is to earn a return on investment, which is the profit or gain earned from an investment.

49. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

50. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

51. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

52. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

53. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

54. The surface of the hockey rink is made of ice, which can be slippery and challenging to navigate.

55. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

56. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

57. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

58. The website's loading speed is fast, which improves user experience and reduces bounce rates.

59. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

60. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

Random Sentences

1. Hindi maunawaan ni Bereti ngunit eksayted siya sa buhay nina Karing.

2. Musk has been named one of the most influential people in the world by TIME magazine.

3. When we read books, we have to use our intelligence and imagination.

4. Saan pupunta si Larry sa Linggo?

5. Ang paggamit ng teknolohiya ay nagbibigay daan sa iba't ibang uri ng hudyat, tulad ng emoji sa text messaging o facial expressions sa video calls.

6. Desde la época medieval, se han practicado diferentes géneros musicales, como el canto gregoriano y el canto mozárabe

7. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

8. Hindi siya maarte sa kanyang damit, ngunit sa kanyang mga aksyon ay makikita mo ang kanyang kahalagahan.

9. I don't want to spill the beans about the new product until we have a proper announcement.

10. Hindi namin mahanap ang tarangkahan ng bahay mo kaya't nag-text kami sa iyo.

11. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

12. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

13. Nagbabaga ang pakiramdam ng kanyang balat dahil sa matagal na pagkabilad sa araw.

14. Marahil ay magpapasko na kaya't maraming tao ang nagpaplanong bumili ng mga regalo.

15. Hang in there and don't lose hope - things will turn around soon.

16. Nanunuri ang mga mata at nakangising iikutan siya ni Ogor.

17. Brad Pitt is known for his charismatic performances in movies such as "Fight Club" and "Ocean's Eleven."

18. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

19. Bakit lumilipad ang manananggal?

20. May bagong promotion ako sa trabaho kaya masayang-masaya ako ngayon.

21. Ang pagiging malilimutin ni Tina ay minsang nagiging dahilan ng kanyang pagkahuli.

22. Isang bata ang lumapit sa magandang babae at nagbigay ng kapiranggot na makakain.

23. But television combined visual images with sound.

24. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

25. Sa mga lugar na may tag-ulan, kadalasang mas madalas magkasakit ang mga tao dahil sa mas mabilis na pagkalat ng mga sakit sa panahon ng malakas na ulan.

26. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

27. The tree provides shade on a hot day.

28. Vi bør fejre og ære vores helte, så de ved, at deres indsats bliver værdsat.

29. Dapat pinakamasaya ang Sabadong ito sa lahat ng Sabado.

30. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

31. Mahalaga ang pag-aaral ng talambuhay ni Marcelo H. del Pilar upang maunawaan ang kanyang papel sa kasaysayan ng Pilipinas.

32. Dinala niya ang regalo sa tarangkahan ng bahay ng kaibigan niya.

33. Kumaripas ng takbo ang batang may dalang bola nang makita ang kanyang nanay.

34. The judicial branch, represented by the US

35. Si Jose Rizal ay pinagpalaluan ng mga Pilipino bilang bayani ng bansa.

36. Pedro! Ano ang hinihintay mo?

37. Ailments are a common human experience, and it is important to prioritize health and seek medical attention when necessary.

38. Ang mahagway na katawan ni Kablan ay naging mahabang isda na may matulis na nguso at matatalim na ngiping parang kakain kaninuman.

39. Naglalaro siya ng video game nang biglang nabigla sa biglang pag-apoy ng computer.

40. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

41. El nacimiento de un bebé puede tener un gran impacto en la vida de los padres y la familia, y puede requerir ajustes en la rutina diaria y las responsabilidades.

42. He has been gardening for hours.

43. Sa mga kasal, kadalasan ay mayroong pagbibigay ng regalo sa mga panauhin bilang pasasalamat sa pagdalo.

44. Omelettes are a popular choice for those following a low-carb or high-protein diet.

45. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

46. They may draft and introduce bills or resolutions to address specific concerns or promote change.

47. Ang paglapastangan sa mga kagamitan at ari-arian ng iba ay isang paglabag sa mga prinsipyong moral.

48. Hindi ka talaga maganda.

49. Biglaan siyang nagpakita sa akin kanina nang hindi ko inaasahan.

50. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

Recent Searches

whichbaliktrabajardecreasesynligeoutpostipakitasenatepinanoodpasannanaisinnagugutomintensidadtupeloattorneyallowingnagpalipatpag-isipanusuarionamumutlamedidanakakasamamalampasanpagtangismasasakitkabuntisansasagotbuung-buomabihisanspirituallegendaryvidenskabennatataposmag-plantnabighanisasamaelementarybeautifultinataluntonpatutunguhanniligawannabiawangnakapaglaroautomatiskhinamakmaliwanagmagpapakabaitnagbababapinaulanannamamsyalmakapagsabimagkasakitpackagingdetallanmakahiramnangagsibiliipinambilireviewerskinakailangangtulisanglobalisasyonkakaibangkinakailangannagliliyabnanghihinamadanongkamalianbeyondniyanggutomhudyateveningnaisubomadridmalulungkotimbeslandcreditalas-tresbedsideokaypisngimasasarapbabaingbaldemakauwiisangmabutingallottedbaliwkaano-anocallinginfinitylunasnagbabakasyontotoopresidentepagbisitamovinghinampaslendadvancedbalinganhelenangingisaybusyanghenryhimihiyawkinapanayam1982watchingteacherpagkasabipinipisildisappointedfuealinpersonsnagkakasyanaritopunongkahoynapadaanviewtalagangdettenakapagreklamoparehongartskasaganaanmagkaharapsasapakinstyleumabotnagtaasmagkasamananood1940ipinikitsapaaanhinfarmgreatermahahabatomorrowcomunicarsesuwailmallidiomababoypelikulanabigaypuntahanh-hoytilgangcementedsoccerhigh-definitioneventsika-12pinsantuloymakakibojuanatinanongpantallasmaubossomipagtatapatskyldes,sinabimatabaanthonyreally2001maninipisnakapuntaogorclientspambatangpag-itimoverallnilangtumagalboardpagdudugopaghamakdapatbulaknakayukomarketplacesvehiclesinirapannatuyospeechesnamisseffectnaturmakatayoseahoneymooners