Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "chambers"

1. Congress is divided into two chambers: the Senate and the House of Representatives

Random Sentences

1. Ayaw ng nanay kong magtrabaho sa Linggo.

2. A father's love and affection can have a significant impact on a child's emotional development and well-being.

3. Les banques jouent un rôle clé dans la gestion de l'argent.

4. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

5. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

6. Ang kelangan mo na lang gawin ay mag dasal..

7. Auf Wiedersehen! - Goodbye!

8. In the years following his death, Presley's legacy has continued to grow

9. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

10. Gawan ninyo ng paraang makalabas po sana ako sa pagkakakulong ko sa loob ng prutas na ito.

11. Nagtaka ito sa pagbabagong-anyo ni Kiko hanggang maging maliit na hayop na animo'y bayawak.

12. Nationalism has been used to justify imperialism and expansionism.

13. Sayang, kapan kita bisa bertemu lagi? (Darling, when can we meet again?)

14. Si Teacher Jena ay napakaganda.

15. Ang lakas ng sagap ng wifi sa kanilang bahay.

16. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

17. Malaya syang nakakagala kahit saan.

18. Binabasa niya ng pahapyaw ng kabuuan ng seleksyon at nilalaktawan ang hindi kawili-wili

19. Emphasis can be used to highlight a person's strengths and abilities.

20. Limitations are the boundaries or constraints that restrict what one can or cannot do.

21. The uncertainty of the job market has led to many people rethinking their career paths.

22. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

23. Sa pook na iyon, sa nakaririmarim na pook na iyon, aba ang pagtingin sa kanila.

24. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

25. May napansin ba kayong mga palantandaan?

26. He used TikTok to raise awareness about a social cause and mobilize support.

27. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

28. Di ka galit? malambing na sabi ko.

29. Ilang taon ka tumira sa Saudi Arabia?

30. Tara na nga Hon! Mga baliw ata yan eh!

31. Pumunta kami sa may bar ng bahay nila.

32. Ang mga magsasaka ay nahihirapan sa kanilang ani dahil sa matinding tagtuyot.

33. Electric cars have lower maintenance costs as they have fewer moving parts than gasoline-powered cars.

34. By refusing to compromise, she ended up burning bridges with her business partner.

35. Some people have a sweet tooth and prefer sweet flavors over others.

36. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

37. El invierno se caracteriza por temperaturas frías y, a menudo, por nevadas.

38. Sino ang maghahatid sa akin sa pier?

39. Dalawang libong piso ang palda.

40. May mga pagkakataon na naisip niyang may kailangan siyang bilhin sa grocery store, pero pagdating niya roon, bigla niyang nalimutan kung ano iyon.

41. Uncertainty about the outcome of the election has caused tension in the community.

42. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

43. Magkakasama ang mga damit nila nina Kano, Boyet at Diding.

44. Nagpamasahe ako sa Boracay Spa.

45. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

46. Manahimik ka na nga, tara ng umuwi! Andyan na driver ko!

47. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

48. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

49. Huh? Paanong it's complicated?

50. Umayos naman ako ng higa at yumakap patalikod sa kanya.

Recent Searches

finishedchambersnaninirahannagnakawkahaponluluwasmakapagsabicultivarpaglalaitaffiliatenageenglishnapaplastikangumagalaw-galawpinakabatangnag-uumirihitsuranagmamadalisikre,pinapakiramdamannagtungoh-hoyphilanthropymangkukulaminsektonghumiwalaymagkasabaymanatiliumakbaytinaypaghaharutanfitnessregulering,kagubatansiguradomahirapmamahalinmagagamitracialenviarhanapbuhaykahongnapuyatabundanteyouthiniresetapinangaralanumagangseryosongnagsamanaglutoescuelasnauntogmatandangsaktanemocionesnagpasamaplaguedexperience,katolikomatulunginhuninakakapuntabiglaankaharianarkilatasapamamahingabumuhosminamasdannilalangriyancharismaticpamimilhingdeletingimageskasalnamawariibonwashingtonpalagimanuksobecametagalogsumamaharingcard1980mulighedsamfundabalanagdalapinyasyashopeegabinglingidbukodcellphoneellanutrientescuentanusedflexiblewordschoicemethodsaffectwithoutbehindanotherdividesimagingbeforestowonderkutodmaglalakadkumbinsihinmatalinomagtataassharenakahantadromanticismodalawangsisidlankitinterestsgutompakakasalannumerosasbinabalikdingginalinmungkahipowersreleasedoffentligabsdilimtipidlumakileaderstemparaturaforskel,inasikasoyoutube,kaninumanbiologinangyaripasyentemahinatinawagpagsahodtengaganunhumpay3hrsbayangkumaenmasarappinaghinabolexpresanparoroonabuwayainakalangnakadapapalabuy-laboymaliksidapit-haponsasayawinwaaadonemagingrichjamesbiroformasmulalet-shirtikinasasabikkwenta-kwentanagtutulungannangagsipagkantahanjejupagbigyannagtataepuntahankolehiyonagpalutopagbebentamasaktannakablueevolucionadotumamismagsisimulalalopanunukso