Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "chambers"

1. Congress is divided into two chambers: the Senate and the House of Representatives

Random Sentences

1. Ang mga turista ay madalas magdala ng mapa para hindi maligaw.

2. I'm so sorry. di makaling sabi niya habang nakatitig dun.

3. Limitations can be self-imposed or imposed by others.

4. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

5. Don't worry about making it perfect at this stage - just get your ideas down on paper

6. Madali ka nitong bibigyan ng paninda kung may sarili kang bangkang paghahanguan ng mga huling isda sa karagatan.

7. El uso de drogas es un problema grave en muchas sociedades.

8. Waaa. Ikaw pala salarin kaya ayaw nya sa ospital!

9. Napahinto siya sa pag lalakad tapos lumingon sa akin.

10. All these years, I have been grateful for the journey and excited for what the future holds.

11. Hiram na libro ang ginamit ko para sa aking research paper.

12. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

13. En boca cerrada no entran moscas. - Silence is golden.

14. Nagtagal ang sakit ni Aling Rosa kaya't napilitang si Pinang ang gumagawa sa bahay.

15. Nationalism has been a driving force behind movements for independence and self-determination.

16. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

17. Bakit ho, saan ninyo ko dadalhin?

18. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

19. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

20. Walang makakibo sa mga agwador.

21. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

22. Till the sun is in the sky.

23. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

24. Les archéologues utilisent la science pour comprendre les cultures du passé.

25. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

26. Ang tagumpay ng aking mga estudyante ay siyang ikinagagalak ng aking puso.

27. Vielen Dank! - Thank you very much!

28. Nasaan si Trina sa Disyembre?

29. Biglaan kaming nag-decide na magbakasyon sa beach ngayong weekend.

30. Ang bilis natapos ng palabas sa sinehan.

31. Sige sa Jolibee tayo. sabi ko.

32. Los agricultores deben estar atentos a las fluctuaciones del mercado y la demanda de sus productos.

33. Las redes sociales pueden ser una fuente importante de noticias y eventos actuales.

34. Ang tarangkahan ay gawa sa matibay na kahoy at bakal.

35. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

36. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

37. Stay there. si Maico sa awtoritadong tono.

38. Sa naglalatang na poot.

39. Nasa ganito siyang kalagayan nang bigla niyang maramdaman ang isang ubos-lakas na sipa sa kanyang pigi.

40. The bird sings a beautiful melody.

41. Emphasis can be used to provide clarity and direction in writing.

42. "Dogs never lie about love."

43. Sorry, I didn't catch your name. May I know it again?

44. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

45. Kumaripas si Mario nang mahulog ang kanyang sumbrero sa kalsada.

46. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

47. Paano umuuwi ng bahay si Katie?

48. Sa gabi, natatanaw ko ang mga bituin na kumikislap sa langit.

49. Bilang paglilinaw, hindi mandatory ang pagsali sa aktibidad na ito.

50. Tumama ang kanan niyang pisngi sa labi ng nabiawang balde.

Recent Searches

intindihintaun-taonmandirigmangnagsasagotchambersmatipunosinaliksiklingidnabasaitinagogisingnagpasyahitsuraiilanchooseleopaglayasbopolskainpulakapainwasteampliatanodadecuadobipolartangekseventagaytaybangkangpinakamahalagangguitarraipinasyangriegatreatsnaiilangactualidadamericaindiacancerkuwentohalakhakumamponkanangmarialalohayaanmusicianspananglawsalatintresgamesthroatmagta-trabahogospelshadeskalabawyamankasintahanmagkasabayindependentlydedication,nalakimismoentertainmentguardaconsumengumiwibintanahandaan1876naglipananggustongtaglagasimpitsigemaasahansinisiraarkilanasaanhuninatapospantalongpamasahelikesmaariespecializadasmalapitannilulonunidosbarnesbulsastarpagpalitumagangtumikimkadaratingcivilizationpaghuhugastaingadefinitivostudentskumikiloschickenpoxpatunayanideyanilinisboyetmagsabifacebookmagamothilignaglabanangjortpuedepumulotoperativosfireworkspointinvolvemanilasinampalpaysagingthroughoutworryexplainpasinghalmanuksoreturnedsettingvotesminu-minutobitawanknow-howrestdinalasubalitrequireaccedermalihismanatiliproblemasabitumalonkatuladbinabapressnasasalinantalentwatchpesobumiliarbularyoipapainitkulangmaluwangjanenakainomselebrasyonasiaticbagaybusogmaidmatapanggusgusinglinggogitanasbio-gas-developinghapdimitigatesarilingtusonglabaskumembut-kembotteachingsplatformpangangatawannagpipiknikdeletingdraft,manakbopasasalamatmulighederpanindangmusicalesmontrealsongsnapanoodbalangcrucialpinilitreviewnagtrabahopinigilanopgaver,kategori,produjokulturpakistan