Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "matipuno"

1. Halos kassingulang niya si Ogor, ngunit higit na matipuno ang katawan nito.

Random Sentences

1. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

2. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

3. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

4. Doa juga dapat dijadikan sarana untuk memohon perlindungan dan keberkahan dari Tuhan.

5. Noong unang panahon may nakatirang mag-ina sa isang malayong pook.

6. The credit check for the apartment rental revealed no red flags.

7. Eine schlechte Gewissensentscheidung kann zu Konflikten und Schwierigkeiten führen.

8. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

9. At være ærlig over for os selv og andre er vigtigt for en sund samvittighed.

10. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

11. Oh Aya, napatawag ka? mejo bagsak ang boses ko.

12. Kailangan ko gumising nang maaga bukas.

13. Nag-umpisa ang paligsahan.

14. La pobreza puede ser un círculo vicioso que se transmite de generación en generación.

15. Kung may tiyaga, may nilaga.

16. Nakilala ko ang taong pinapangarap ko kaya masayang-masaya ako ngayon.

17. Algunas serpientes son conocidas por su capacidad para camuflarse en su entorno, lo que les permite acechar a sus presas de manera efectiva.

18. Ang pagbabayad ng utang ay magpapakita ng pagiging responsable sa pagpapalago ng financial status.

19. He teaches English at a school.

20. Ang paglapastangan sa ating mga tradisyon at kultura ay isang pagkawala ng ating pagkakakilanlan.

21. Ang kahirapan ay isang laganap na suliranin sa ating bansa.

22. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

23. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

24. Mas masarap ang pulotgata kapag inilagay sa ibabaw ng bibingka.

25. Regular grooming, such as brushing and bathing, is important for a dog's hygiene.

26. Oh, eh bakit naman? tanong naman nung isa.

27. Elle peut être interne, c'est-à-dire provenant de soi-même, ou externe, provenant de l'environnement ou de la pression sociale.

28. Wala na naman kami internet!

29. Women have shown remarkable resilience and strength in the face of adversity and oppression.

30. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

31. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

32. Hvis man oplever smerter eller ubehag under træning, er det vigtigt at stoppe og konsultere en sundhedsprofessionel.

33. Pakukuluan ko nang apat na oras. Ikaw?

34. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

35. La mer Méditerranée est magnifique.

36. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

37. At sa tuwing tataas, hahanapin ako ng tingin sa baba at malungkot nangingitian.

38. It's frustrating when people beat around the bush because it wastes time and creates confusion.

39. Sayang, apakah kamu bisa mengambil anak-anak dari sekolah nanti? (Darling, can you pick up the kids from school later?)

40. Nous avons embauché un DJ pour animer notre soirée de mariage.

41. Napakalamig sa Tagaytay.

42. Es importante estar atento a las plagas y enfermedades, y utilizar métodos orgánicos para controlarlas

43. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

44. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

45. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

46. El actor hizo un comentario controversial que está llamando la atención de los medios.

47. Sa loob ng bilangguan ay doon rin niya nakilala ang isang pari, si Padre Abene

48. Natawa nanaman sya, Hindi, maganda sya.

49. Inflation kann sowohl kurz- als auch langfristige Auswirkungen auf die Wirtschaft haben.

50. Pagkatapos ay abut-abot ang kanyang paghingi ng paumanhin sa mga duwende.

Recent Searches

matipunomaisresponsiblenababalotespanyolbilanggoromeronapakalamigfreedomsmesafulfillingpalaypagsalakayaraw-arawbiologimahalaganapapag-usapantaledespitemaramingboyetpagsasalitaextratatlobopolsdalanghitahotdogvivasipaipapahingamaynilahawakandamimamayauusapanagam-agamhoweverbisitamahaltinysugatang3hrstatanggapinlungkottagalogbeyondnandoonnapakaramingpapuntabuksansunud-sunurantinitignankarununganmulti-billionmaarimemorialpunong-punomahiyakunesobrangiyonpag-uugalinilimasmunapatulogjanekasalukuyangjunekampanapopcornsiyudadnakapayongnagtagisanmakasahodipaalamkulangpaghingidentistakasosusunodsabihingumalismatulungindiyanhospitalmarianculturahalamananpresyonakarinigdahan-dahanbukaskadaratingnandiyangjortkinaumagahanumiibigk-dramasiembraputahekasawiang-paladditoprusisyonmisusedkaguluhanwestdeathadobonoonalsopaghakbanghopethesebutpakikipagbabagkulunganproductividaddagokaccessgiraysisidlanshutmagkamalinaglaonentoncesnabiawanghimigkasalananhukaymagsasalitanalalamanritomagwawalanagugutomnangagsibilistatesextremistmagandalumabasgagawaquarantinesumarapreaksiyonmakikiraanpusakwelyoincludepapanigpondomarielshiningnerotsakanaiwangfathertheirlumingontherenobelapinabulaanpakanta-kantangmalihispamumunotumalonasklumalakikumainalexandertinikcivilizationblendkilalang-kilalaunti-untinghinamonninyomapagbigaysocietydrinkskalawangingperpektolordsuccesskabilangmapapabilangguanrosellenagkitabastapagkaganda-gandabarreraseskwelahankuwentoganitoinnovationmagpupuntakubokoreaumagangpagsigawbasa