Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "matipuno"

1. Halos kassingulang niya si Ogor, ngunit higit na matipuno ang katawan nito.

Random Sentences

1. I'm going through a lot of stress at work, but I'm just trying to hang in there.

2. Nag-iisa siya at tulala sa gitna ng kalsada nang makita ko siya kaninang umaga.

3. Kung hindi siya maramot, baka mas marami ang natulungan niya.

4. Pupunta ako sa Germany sa susunod na taon.

5. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

6. Saan pumupunta ang manananggal?

7. Las serpientes son animales solitarios y, en su mayoría, evitan el contacto con los humanos.

8. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

9. Huwag kaybilis at baka may malampasan.

10. This is my girl, Jacky. pagpapakilala ni Maico sa akin.

11. She decorated the cake with colorful sprinkles and frosting.

12. Claro, podemos discutirlo más detalladamente en la reunión.

13. Les enseignants peuvent organiser des projets de groupe pour encourager la collaboration et la créativité des élèves.

14. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

15. They have been friends since childhood.

16. Sa kanyang masamang gawain, nai-record ng CCTV kung paano siya na-suway sa patakaran ng paaralan.

17. Baby fever can affect people of various ages, backgrounds, and genders.

18. Sa aking balkonahe, ako ay nagtatanim ng mga maliit na halaman upang magkaroon ng kahit konting berdeng espasyo.

19. La creatividad es esencial para el progreso y el avance en cualquier campo de la vida.

20. The politician made a series of speeches, outlining her plans for improving healthcare.

21. Maaaring maging verbal o non-verbal ang hudyat, tulad ng pagtango, pagngiti, o pagsulyap.

22. Ang sugal ay isang maling paghahangad ng mga tao na magkaroon ng mabilis na yaman.

23. Maghapon nang nag computer ang kanyang anak.

24. Nangahas ang binata na sumagot ng pabalang sa kanyang ama.

25. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

26. He has been to Paris three times.

27. Television is one of the many wonders of modern science and technology.

28. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

29. La esperanza y los sueños son las llaves para la felicidad y la realización personal. (Hope and dreams are the keys to happiness and personal fulfillment.)

30. Ayos ka lang ba mahal ko, bakit parang namumutla at namamayat ka? tanong ng binata.

31. Mahalaga na maging bukas ako sa mga taong maaaring makatulong sa akin upang maalis ang aking mga agam-agam.

32. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

33. They are often served with a side of toast, hash browns, or fresh greens.

34. El arte renacentista fue una época de gran florecimiento del arte en Europa.

35. Oh, kinaiinisan mo pala? Eh bakit naging paborito mo?

36. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

37. Maliksi siyang lumapit at binatak ang bata sa liig.

38. Huwag daw siyang makikipagbabag.

39. "A dog is the only thing on earth that loves you more than he loves himself."

40. Det er vigtigt at give børn en kærlig og støttende opvækst.

41. Ikinasuklam ko ang ginawa ni Pedro.

42. ¡Feliz aniversario!

43. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

44. Napansin niya ang mababa ang kita ng tindahan nitong buwan.

45. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

46. We sang "happy birthday" to my grandma and helped her blow out the candles.

47. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

48. Ang pagiging hospitable ay likas na katangian ng mga Pinoy.

49. Football is known for its intense rivalries and passionate fan culture.

50. Nous avons opté pour une cérémonie de mariage intime.

Recent Searches

matipunohihigachoirmagbubukidmalapitanupuanmasarapplanning,sineproudumiibigitutuksoanywhereutilizarmalumbaydeathantesmagbibitak-bitaknoonkamoteberetihunyovedpunongkahoyabigaelnapakahabamaghahabikutsaritangbankmakapangyarihangnaglabaililibreeleksyonnagpapakainomfattendeidiomasumaraplangyaadecuadorememberedassociationgayunpamanbarrierspinapasayabecomingchuntag-arawclassroomsaankaawaywalangpagsalakaylikodinangtelebisyonkristobaorepublicanhalaganangyarianukatipunanpawispromotemerchandisehinipan-hipanikinalulungkotnagsilabasanalas-diyestuluyannagpapaigibnagulatpagtatapospulisnagkasunognakadapanagliwanagmananalosumusulatprimerosilalagaykahongintramurosgiyeratinahakonline,nagbentahaltiniresetasuccessfulhinamakjagiyaplantartalagangbeganpagmasdanteachingsmaynilacarepandidiridisensyodiscipliner,umupokoronanakabaonattractivenilayuannangapatdanfremstillepantheonnakainomnagsusulputannabagalancalidadablenayonmisteryoparoroonaanonginiisipubotapelendingdennesupremenamulaklaksangsenatemahagwaymeaningwalngbagyogearkamakailanmanuscripteventscontestboksingprobablementebagaymulayudastudentfacilitatinglcdconsiderarmetodetillimiteditordecreaseourmanlalakbayanibersaryomaihaharaptatawagnakahigangkumaliwamagtatakatulisankangitankumilospantalonanumangrisksumalakaypinagawabrancher,maipapautangculturasmay-bahaylakadstreetbopolspangilkapagdyiplaroonlinedangerouseuphoriccombatirlas,hojasgivekabosesbarrocoingatanchavitleukemiasumindibillpasyawidekagayameetinglupainkinakitaanbilhinautomationmag-uusap