Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "felt"

1. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

2. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

3. Jeg har aldrig følt mig så forelsket før. (I've never felt so in love before.)

4. The backpack was so hefty, it felt like it weighed a ton.

5. The depth of grief felt after losing a loved one is immeasurable.

6. Today, Bruce Lee's legacy continues to be felt around the world

Random Sentences

1. Walang huling biyahe sa mangingibig

2. Les sciences de la Terre étudient la composition et les processus de la Terre.

3. Kina Lana. simpleng sagot ko.

4. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

5. Maaga kaming nakarating sa aming pupuntahan.

6. Lalo itong nalungkot nang malamang magdaraos ng isang handaan ang Adang kagubatan.

7. Human activities, such as pollution and deforestation, have a significant impact on the environment.

8. Jacky! magkasabay na sabi nung dalawa.

9. Yari sa kahoy ang sahig ng bahay ko.

10. He is also relieved of the burden of needless expenses and ultimately becomes a happier and healthier citizen

11. Sa aming eskwelahan, ang mga mag-aaral ay nagtatanim ng mga gulay sa school garden.

12. May malawak na lupain ang kanyang mga magulang.

13. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

14. Nagkakamali ka kung akala mo na.

15. Pinakamatunog ang tawa ni Ogor.

16. Ang alon sa karagatan ay malakas ngayon dahil sa bagyong dumaan.

17. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

18. Pinangaralan nila si Tony kung gaano kahalaga ang isang ama

19. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

20. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

21. Musk has been married three times and has six children.

22. Ang buhay at mga akda ni Rizal ay patuloy na pinag-aaralan at pinag-aaralan ng mga estudyante at mga historyador sa buong mundo.

23. Lumiwanag ang silangan sa pagsikat ng araw.

24. Ang pagpili ng mga kasuotan para sa kasal ay dapat ayon sa tema ng kasal.

25. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

26. Dumating ang mga kamag-anak ni Fe.

27. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

28. Sinundan ito ngunit nawala nang sumuot sa nakausling ugat ng puno.

29. Nabangga ang kotse ni Juan bandang alas-tress ng hapon.

30. Natuto akong magluto ng masarap na pagkain kaya masayang-masaya ako ngayon.

31. I don't want to beat around the bush. I need to know the truth.

32. Marurusing ngunit mapuputi.

33. Einstein was a pacifist and spoke out against war and violence throughout his life.

34. Repeated frustration can lead to feelings of hopelessness or helplessness.

35. The app has also become a platform for discovering new music, with songs going viral through TikTok.

36. Nag-ugat sa puso ni Durian na mahalin ang sakop ng kanyang ama.

37. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

38. Cocinar en casa con ingredientes frescos es una forma fácil de comer más saludable.

39. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

40. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

41. Pwede ba kitang tulungan?

42. Ang mga punong-kahoy ay kabilang sa mga pangunahing likas na yaman ng ating bansa.

43. Ito ho ba ang pinauupahang bahay?

44. Sa gitna ng katahimikan, nakita ko siyang tulala sa kanyang pag-iisip.

45. Ang guro ko sa Panitikan ay nagturo sa amin ng mga panitikan mula sa iba't ibang panahon.

46. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

47. Bagaimana bisa kamu tiba-tiba hilang begitu saja? (How could you suddenly disappear like that?)

48. Time heals all wounds.

49. A couple of coworkers joined me for lunch at the cafe.

50. Nakikita ko ang halinghing ng mga bata habang naglalaro sa parke.

Recent Searches

andamingfeltsiemprehitiksinapakiguhitbabesdettetenjackyhumanosrhythmtryghedbabaeouesakinpang-araw-arawmagpa-paskohinihilinghiningiandrewcondostonehamputahephysicalyansumalipasangmealbahamapadalidaigdigochandoshockipasoknameipipilitislaformbehindstageipagtimplamaputipinalakinghalikaexitmakingbilugangtwocontinuedactivityentercreatingclassmatestoplightcornerwhymapthirdamazonelectbetweencertaintableshiftkapilingprogramaexamplesyncmakapilingerrors,rodonasasabihineskuwelahanbangladeshpaghalakhaknapakahusaynagsagawanalugmokpanalanginbumagsakangkanmakikitulogkangitanmateryalesnanlilimahidlansangantungobighaniadmiredincitamentermaya-mayapinisilmaligayaganyantomorrowpangkatlungkotnaglalababwahahahahahaamolikelypaslitna-fundayangirlbrucekasoindiaeksport,perseverance,layawproductscarbonbinatakiatfpatunayanlinggomrsbutihingsigapangitalamclientemeanconectadosgitnaadvancedskyldesaddresssubjectsugalnamilipitinterestssigngearmaulinigannagawaboracaypangingimiwalnggreweksaytedenfermedades,zebramatalimbilinduranteulammasdantaun-taondosenangibinigaycompletefireworksdogwatchpartnerventakaringkatagalaccuracyactorconventionalspaghettilategranadaimproverelievedprovideddevicesbeganformassocietypresstokyoreadandygoinggenerationsmaghilamosbeniiklidependingtelangumaagoskaaya-ayangnagpakitadatapuwakablanagaeffectkantostudentsnobleipinansasahognagpalutobumibitiwkwartobansang