Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "tokyo"

1. Nagtuturo kami sa Tokyo University.

2. Sa Tokyo Olympics 2020, napanalunan ni Hidilyn Diaz ang gintong medalya sa weightlifting.

3. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

4. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

Random Sentences

1. Papasa ka kung mag-aaral ka ng leksiyon mo.

2. Laking galak nito nang matagpuan ang maraming itlog ng bayawak, at tuwang-tuwa na tinirador ang mga itlog.

3. Ang paggamit ng droga ay maaaring magdulot ng pagkabaliw, paranoia, pagkabalisa, at pagkakaroon ng kawalan ng pag-iingat sa sarili.

4. Ang paglapastangan sa mga propesyonal at kanilang propesyon ay isang paglapastangan sa kanilang dedikasyon at pagsisikap.

5. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

6. Nagtatrabaho ako sa Youth Center.

7. La santé est un état de bien-être physique, mental et social complet.

8. Sa loob ng simbahan, natatanaw ko ang magandang retablo at mga banal na imahe.

9. Nasa kanluran ang Negros Occidental.

10. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

11. Mauupo na lamang siya sa kanyang balde.

12. Gumagalaw-galaw ang sabog na labi ni Ogor.

13. Sa hirap ng buhay, ang aking kabiyak ay ang aking kakampi at kasama sa pagtahak ng mga hamon.

14. Ang mga punong-kahoy ay kabilang sa mga pangunahing likas na yaman ng ating bansa.

15. Have you tried the new coffee shop?

16. He used credit from the bank to start his own business.

17. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

18. Huwag daw niyang papansinin si Ogor.

19. I finally quit smoking after 30 years - better late than never.

20. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

21. Dapat bigyang-pansin ang pangamba ng mga bata at tulungan silang maunawaan ang mga posibleng banta.

22. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

23. Natutuwa ako sa balitang iyan mahal ko.

24. The mission was labeled as risky, but the team decided to proceed.

25. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

26. Sa mundong ito, hindi mo alam kung kailan ka magiging biktima ng agaw-buhay na krimen.

27. Nagpapasalamat ako sa Bukas Palad dahil sa kanilang mga kanta ay nakakatulong sa akin na maging mas malapit sa Diyos.

28. Bakit naman kasi ganun ang tanong mo! yan ang nasabi ko.

29. Nationalism has been used to mobilize people in times of war and crisis.

30. Las labradoras son excelentes perros de trabajo y se utilizan a menudo en búsqueda y rescate.

31. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

32. ¡Muchas gracias!

33. Las serpientes juegan un papel importante en el equilibrio de los ecosistemas al controlar las poblaciones de roedores.

34. Protecting the environment involves preserving natural resources and reducing waste.

35. She has quit her job.

36. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

37. All these years, I have been striving to be the best version of myself.

38. Les robots dotés d'intelligence artificielle peuvent effectuer des tâches répétitives et dangereuses pour les humains.

39. He is taking a photography class.

40. Cada nacimiento trae consigo la promesa de un futuro lleno de posibilidades.

41. Jacky! magkasabay na sabi nung dalawa.

42. Mathematics is an essential subject for understanding and solving problems in many fields.

43. Ilang beses ka nang sumakay ng eroplano?

44. Maingat na nangampanya ang mga kandidato ayon na rin sa alituntunin ng IATF.

45. Naku di po ganun si Maico. automatic na sagot ko.

46. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

47. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

48. Ang nagbabago ay nag-iimprove.

49. El graffiti en la pared está llamando la atención de la policía.

50. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

Recent Searches

pinamalagitokyomagsugalpasasalamatdesdesumisidmayokinalilibingandressmalinabigkasmagbagong-anyouwakpebrerovedcynthiapwestocalciummonsignorsikipbaulsumugodmatipunopierkumampitanggalinasawakontingmensajespinanawancarolgisingsincetruesaynothinglibropagodlasingerosumapitmagsusunurankare-karemakakibomestmagpuntamatulissasakyanpiecesconditioninglorenascottishnakadapaalbularyokamiumagainteractnavigationrequireulosafemrsasimtinitirhanhidingpinuntahanbitiwan11pmharpsantosnapakabaittagumpaymaarichamberschickenpoxtinigilhealthiermaputulanbrainlysugattumayodeletingmagkakaanaknagtitiisnakahugbabemagdoorbellmanggagalingagebestidapagbibironamatayapptignanbumuhosibalikevenpasalamatannauntogdurimagbabagsikdi-kawasanararapatpinangalananlumangcardiganadvertisinglibertykanayangiloilokarapatanrepublicanpinagalitankategori,kutsaritangnakakabangonrenombresaritaakmangnahihiyangawitinmadurasgasolinamamanhikanpagpapautangnuondeathnageenglishbumibitiwleksiyonsanpaglisanhdtvnaintindihanmaskinerticketkabighakundimanhallmeanspaumanhinfonosmayamanboksingmagtiwalanakitulognakakadalawtrafficpaglalayagpitakasumasayawbiglaanmagulayawcaraballodisyembrerisepaglalabaparobulatepinalutonagpasamakasingsubalitchangecommercenagdarasalinimbitainilabasplatformsreplacedatensyonmaibalikreguleringnaglutoaalismangingibigcolordebatesagosgagambalamangtwofueelvistransmitscryptocurrencyibinentaherramientahamaktumutubonilutonaglulusakbasahannapakabiliseditinformedpangakospecializedrisksumabogexpectations