Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "legislative"

1. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

2. Representatives participate in legislative processes, proposing and voting on laws and policies.

3. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

4. The legislative branch, represented by the US

5. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

Random Sentences

1. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

2. Women have made significant strides in breaking through glass ceilings in various industries and professions.

3. Ako po si Maico. nakangiting sabi niya.

4. Ang droga ay hindi nagbibigay ng solusyon, kundi dagdag na problema pa.

5. Einstein's writings on politics and social justice have also had a lasting impact on many people.

6. If you want to get the best deals at the farmer's market, you have to be the early bird.

7. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

8. The pretty lady in the movie stole the protagonist's heart.

9. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

10. Kahit ang paroroona'y di tiyak.

11. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

12. Isang makisig na binata na halos kaedad din ng magandang prinsesa.

13. Me duele la espalda. (My back hurts.)

14. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

15. Sa muling pagkikita!

16. Les sciences sociales étudient le comportement humain et la société.

17. Samahan mo ako sa mall for 3hrs!

18. Ang kagutuman ay laganap sa mga lugar na may kalamidad.

19. Kapag ako'y nasa eroplano, natatanaw ko ang iba't ibang mga pook sa ibaba.

20. Habang nagtatanim sila, tinatangay ng hangin ang mga buto palayo sa lupa.

21. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

22. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

23. The lightweight fabric of the dress made it perfect for summer weather.

24. The sunset view from the beach was absolutely breathtaking.

25. My friend was better off not knowing about her boyfriend's infidelity - ignorance is bliss, or so they say.

26. Inirekomenda ng guro na magbasa kami ng maraming aklat upang mapaunlad ang aming kasanayan sa pagbabasa.

27. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

28. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

29. Kasama ng kanilang mga kapatid, naghihinagpis silang lahat sa pagkawala ng kanilang magulang.

30. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

31. Binilhan ko ng kurbata ang tatay ko.

32. We finished the project on time by cutting corners, but it wasn't our best work.

33. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

34. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

35. Skynd dig ikke for meget. Du kan falde og slå dig. (Don't hurry too much. You might fall and hurt yourself.)

36. Claro que te apoyo en tu decisión, confío en ti.

37. Ilang beses ka nang sumakay ng eroplano?

38. Omelettes are a popular choice for those following a low-carb or high-protein diet.

39. Los recién nacidos son pequeños y frágiles, pero llenan nuestros corazones de amor.

40. Wasak ang kanyang kamiseta at duguan ang kanyang likod.

41. Wag kana magtampo mahal.

42. I absolutely love spending time with my family.

43. Ang mahagway na katawan ni Kablan ay naging mahabang isda na may matulis na nguso at matatalim na ngiping parang kakain kaninuman.

44. I am not teaching English today.

45. Nangangako akong pakakasalan kita.

46. Umalis siya papuntang Cebu kahapon ng hapon.

47. Heto po ang isang daang piso.

48. Puwedeng gamitin ang pagguhit upang mag-drawing ng mga bagay na gusto mong ma-achieve sa buhay.

49. Ang sugal ay isang hindi wastong paraan ng paghahabol ng pera at tagumpay.

50. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

Recent Searches

legislativejackydamitclaracarolbulsabuhokboseslotdaddykiloaleaddressnakatawagpinunitboholbisigsetsbastawhichincreaserecentblessilanbakalawardaalisprogramashiftsettingsystemmundoviolenceallganakatipunanbarung-barongutilizarkalikasannakauwibuung-buosilid-aralanaddingsilyakalalaroteleviseddoondownibabacrucialchambersrebolusyonnilutopinaghatidanmagbabagsiknagwalismangiyak-ngiyakagwadornagta-trabahonagre-reviewnalalaglagnagbakasyonmommysikokara-karakapagpapautangsimbahannakakasamapinagalitannakaka-innagkwentodisenyongtiradornegosyantenakakagalakalabawnakapasanagtakapalaisipanmag-isangbahaydraybermikaelanakitulogdistancianapuyatpamasahelinggongbusiness:ipinansasahogkristokaraokenandyanrimaspromisesingaporeellatanda1973sinongloriuulaminkaguluhaningatankabundukanmawawalaadverselykayongbilibidrealisticnapapatinginumaasanakaakyatgalawcampaignsmahigitsamakutsaritangtitanunwashingtonvetoiniibigriyanfundrisekasakittumubokandidatotokyocontestsalitangchickenpoxsumpainmatipunosmileganangtapatlandovalleymapaibabawdyipnaggalabagyobecomegatheringamparomaarimeaninglargersinipangdinalawdumadatingtelanggamotwordscantobilhinbansalendorasaneditpacesupportterminfluencekaninokumaliwapakibigyanakominamahaladvancednanaigmagsungitibinaontenernakakarinigniyasaan-saanlinya1929hinigitpriestfameinterestsmanuksobayankayang-kayangbaku-bakongpsssiigiblarongganitoiyakuntimelypatutunguhankumbinsihinnageenglishkumukuhaindustriyalarangan