Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "opt out"

1. Come on, spill the beans! What did you find out?

2. Einstein was a member of the NAACP and spoke out against racism in the United States.

3. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

4. Einstein was a pacifist and spoke out against war and violence throughout his life.

5. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

6. He blew out the candles on his birthday cake and made a wish.

7. I accidentally let the cat out of the bag about my friend's crush on someone in our group.

8. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

9. I don't want to get my new shoes wet - it's really raining cats and dogs out there.

10. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

11. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

12. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

13. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

14. It was supposed to be a surprise promotion, but the boss let the cat out of the bag during a meeting.

15. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

16. Let the cat out of the bag

17. Let's just hope na magwork out itong idea ni Memo.

18. My boyfriend took me out to dinner for my birthday.

19. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

20. My favorite thing about birthdays is blowing out the candles.

21. Pull yourself together and let's figure out a solution to this problem.

22. Remember that the most important thing is to get your ideas and message out to the world

23. Scissors should be handled with care to avoid injuries and kept out of reach of children.

24. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

25. The disagreement between them turned out to be a storm in a teacup.

26. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

27. The event was sold out, and therefore we couldn't get tickets.

28. The politician tried to keep their running mate a secret, but someone in their campaign let the cat out of the bag to the press.

29. The restaurant bill came out to a hefty sum.

30. The website's contact page has a form that users can fill out to get in touch with the team.

31. There?s a world out there that we should see

32. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

33. Those experiencing baby fever may seek out opportunities to be around children, such as babysitting, volunteering, or engaging with family and friends who have kids.

34. We sang "happy birthday" to my grandma and helped her blow out the candles.

35. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

36. We were trying to keep our engagement a secret, but someone let the cat out of the bag on social media.

37. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

Random Sentences

1. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

2. Punta tayo sa park.

3. Wait lang ha kunin ko lang yung drinks. aniya.

4. Women have diverse experiences and backgrounds, including those based on race, ethnicity, and sexual orientation.

5. Ilan ang computer sa bahay mo?

6. Budgeting, saving, and investing are important aspects of money management.

7. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

8. Saan ka kumuha ng ipinamili mo niyan, Nanay?

9. All these years, I have been working hard to achieve my dreams.

10. Les écoles offrent une variété d'activités parascolaires telles que le sport, la musique et le théâtre.

11. Napatungo ako dahil nangingilid na naman ang mata ko.

12. "Every dog has its day."

13. At have håb om en bedre fremtid kan give os troen på, at tingene vil blive bedre.

14. La tos es un mecanismo de defensa del cuerpo para expulsar sustancias extrañas de los pulmones.

15. Makaka sahod na siya.

16. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

17. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

18. Batang-bata ako nalalaman ko 'to.

19. Nakatanggap kami ng masamang balita na ang aking kaibigan ay nawala at ito ay lubos naming ikinalulungkot.

20. Nakasuot ng pulang blusa at itim na palda.

21. Kapag may kailangang desisyunan, hindi maiiwasan na magkaroon ng agam-agam sa kung ano ang tamang hakbang.

22. Ganun talaga. Simpleng sagot ko.

23. Humayo ka at hanapin mo ang dalagang sinasabi ko para mabalik ang dati mong anyo, ang utos ng engkantadang babae.

24. Nakagagamot ng diyabetis ang halamang ito.

25. Ang kakahuyan sa bundok ay mayabong at puno ng iba't ibang mga uri ng mga halaman.

26. Mi amigo de la infancia vive ahora en otro país y lo extraño mucho.

27. Paborito nyang panoorin ang Baby shark sa youtube.

28. She enjoys taking photographs.

29. Tinatawag niya ang anak ngunit walang sumasagot.

30. Sa gitna ng dilim, dumaan ang magnanakaw sa likuran ng bahay.

31. Ang paggamit ng mga apps at gadgets bago matulog ay maaaring makaapekto sa kalidad ng tulog ng isang tao.

32. Hockey coaches develop game plans and strategies to help their team succeed.

33. Tinanggal ko na yung maskara ko at kinausap sya.

34. Nabagalan ako sa simula ng pelikula.

35. Nasa harap ng pinto ang dalawang aso.

36. The backpack was so hefty, it felt like it weighed a ton.

37. Kapag may mga hindi malinaw na plano sa buhay, maaaring magdulot ito ng agam-agam sa mga tao.

38. Puwede akong tumulong kay Mario.

39. Ibinigay ko ang aking tulong sa mga naghihirap upang masiguro ang kanilang kaligtasan.

40. Ang mga halaman ay dapat na pinapakain sa regular na may compost o fertilizer upang matiyak na sila ay may sapat na nutrients para sa paglaki

41. Ang mga natatanging kontribusyon ng mga siyentipiko sa kanilang larangan ay dapat na itinuring at ipinagmamalaki.

42. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

43. Gusto po ba ninyong lumipat sa ibang kuwarto?

44. Malamig sa Estados Unidos kung taglagas.

45. Bilang diwata ay wala siyang kapangyarihang magdugtong ng buhay, datapuwa ang magbigay ng panibagong buhay sa bagong anyo ay kanyang magagawa.

46. Wala na siguro sya, baka natulog na inantok na.

47. Nagsisilbi siya bilang security guard upang protektahan ang mga tao at ari-arian.

48. Tse! Anong pakialam nyo? Bakit maibibigay ba ninyo ang naibibigay sa akin ni Don Segundo? sagot ni Aya.

49. Pasensya na pero kailangan ko nang umalis.

50. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

Recent Searches

naiwanpitakaimikginangharapanressourcernenaghilamosginooaltkinukuyombakurandinnalagutaniilanulandiedcreatividadplantarnogensindemartapolonamumulaangkankasyachoicelaroligaanosisikattinutopsubalitpagkalitoilanhagdananpaghihingalorinriyandahiliniirogpagdiriwanglargemunangpagkaganda-gandangumitinagginglumagopinamumunuanformpiyanomagkaibanalalarohamakmahiyanakuhangnagbanggaanricahiningalabingtodasdivisorialunestahimikbilanginpaldakagandahannamataysariwaparoroonaoutlinepaanopinalakingmemorialmalagothanksgivingturismoultimatelybunutanhinukaykabilangbarosiponpumatolnakalilipasnapabayaanmaipapamanakinuskosclassmateipinagdiriwangnakisakaypinagawadisenyocoaching:makatawarabeeroplanogumisingmatakawisa-isakinagabihanhimutoknakaupointeragerernagbabakasyonnapakahanganicekagatolinyojunioginoongtatlokatibayangprogramsgamestaousaentrancesigurohinanakitnunadvancestofilipinalargopagkabuhaymaistorbosamakatuwidbilipagawainkusinamaalalayouthendrefscientificpistapresidenteopohinahanappapaanoalwaysjennyprimeraspangalanaddinglabanamananinirahanrestfauxpumapasokorkidyasfreeisinampaymagtrabahotonycontrolabinigyangvetolalongtumalonpatayhardeventsnag-replylasingnapakaningningtradetinanggapadmiredminahankagyatmahulogkasakitvibrateareasilamag-isangpagbabasehandurinag-asaranmaalikaboknakapagusapmatasumasakayinvestingshowskikitasugalmagkasinggandapamilihandahan-dahansunud-sunodlahattomtayokahitnakumbinsihashvornagpapanggap