Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "brought"

1. A couple of photographs on the wall brought back memories of my childhood.

2. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

3. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

4. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

5. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

6. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

Random Sentences

1. La técnica de sfumato, que Da Vinci desarrolló, se caracteriza por la suavidad en la transición de los colores.

2. El que mucho abarca, poco aprieta.

3. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

4. The river flows into the ocean.

5. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

6. Kahit na maliit ang kanyang bahay, basta't nagmamahalan ang mga tao, sapat na iyon.

7. Børn bør lære at tage ansvar for deres handlinger og træffe gode beslutninger.

8. The football field is divided into two halves, with each team playing offense and defense alternately.

9. Sino sa mga kaibigan mo ang matulungin?

10. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

11. Nosotros nos disfrazamos y vamos a fiestas de Halloween durante las vacaciones.

12. The movie was absolutely captivating from beginning to end.

13. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

14. Ku, e, magkano naman ang laman? ang tanong nga babae

15. Ikinagagalak kong makita ang pag-unlad mo sa buhay.

16. Bumuhos ang pawis niya sa sobrang gutom at naglalaway na siya.

17. Masarap higupin ang sinigang na may maraming gulay.

18. Isa daw siyang mabangis na hayop dahil tulad nila meron din siyang matatalim na mga pangil.

19. Some scissors have adjustable tension screws that allow users to customize the tightness of the blades.

20. Sebagai bagian dari perawatan pasca kelahiran, ibu disarankan untuk menghindari aktivitas fisik yang berat dan menjaga pola makan yang sehat.

21. Sa takot ng mga tao sa pagsalakay ng mga tulisan, ibinaon nila ang gong sa isang lugar na malapit sa gubat.

22. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

23. Bumili si Ana ng regalo para diyan.

24. In der Kürze liegt die Würze.

25. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

26. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

27. Ang dentista ay propesyonal na nag-aalaga sa kalusugan ng ngipin at bibig.

28. There's no place like home.

29. Football is a popular sport for both men and women, with many professional women's leagues around the world.

30. Isa lang ang bintana sa banyo namin.

31. Limitations can be financial, such as a lack of resources to pursue education or travel.

32. Una de mis pasatiempos más antiguos es coleccionar monedas y billetes de diferentes países.

33. Ang tarangkahan ay gawa sa matibay na kahoy at bakal.

34. Hindi mo inaasahan na ang simple at normal na araw ay maaaring magdulot ng agaw-buhay na pangyayari.

35. Good morning, Beauty! aniya sabay halik sa mga labi ko.

36. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

37. Ang pag-asa ay maaaring magdulot ng positibong pagbabago sa buhay ng mga tao.

38. The victim was able to identify the culprit who had been harassing them for months.

39. Hvis man oplever smerter eller ubehag under træning, er det vigtigt at stoppe og konsultere en sundhedsprofessionel.

40. The Great Barrier Reef in Australia is a wonder of marine life and coral formations.

41. Hinintay kong magsalita si Kuya Patrick sa kabilang linya.

42. Sino-sino ang mga kakuwentuhan mo sa klase?

43. Gumawa si Tatay ng makukulay na saranggola para sa piyesta.

44. Tila uulan ngayong hapon dahil sa madilim na ulap sa langit.

45. Pagkat kulang ang dala kong pera.

46. Sa pamamagitan ng bayanihan, nagkaroon kami ng pag-aayos ng mga kalsada sa aming lugar.

47. Ang punong-kahoy ay nagbibigay ng sapat na lilim para sa mga nilalang na nabubuhay sa ilalim nito.

48. Congress, is responsible for making laws

49. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

50. Mabuti na lamang at nandyan ang kanyang kaibigan.

Recent Searches

gisingmanydoktor1980dollybumahabroughtmadamiultimatelymatagpuanitinagofonoseuphoricpinangalanangresort00am1787omgmodernepanaybrucesagabalgusalitransmitidaspamanaplicasouthsingerlackmapuputiplatformcallingavanceredenagsagawaprogramasedentaryadditionallypulangilanthroughoutfuncionesdinitabassaginglaspartnerdeledaangluisyoungminutemalimitcondocharmingbulalastulogbringingbathalaimagingcreationuponmuchmalakingwaysrolledmapapatiposcleardinalaaddareareportochandolcdtinaposeffectguideremoteyeheyaffecte-booksbitbitworkingmastercertainpracticeslearninteligentesreadbroadcastsmaratingeditorjohnimpactedthingdamijodiekinapalitankumalmapambatangkomunidadbobonag-aabangbroadcastuntimelynoongitinaponbunutanbangaaninagtalagamanlalakbaylumipadblusaangkanrequierenuniversitiesalanganmaluwagsasabihinmaghilamospasaheromalalakialakangheltenderahasantoktodayreservedsagotconvertidasospitalkayakwebangfacultyclockcontinueiskedyulfulfillingtarcilaapoyadvancematuliscarmeniyonaeroplanes-allkarapatankulotbinibilanglayawandrescapacidadayawsalamangkeroisinulatbaranggayinspirasyonnangampanyanagulatressourcernenagkakakainnakagalawkumakalansingeskuwelahannapaplastikanpagpapatubodemawang-awabumabahakangmedya-agwakapangyarihannamumukod-tanginangagsipagkantahankinatatalungkuanggeologi,nagpapaniwalapinagkaloobangayunpamanangkopnagpasangruponakuhangnakaririmarimtumawagalbularyonagpabayadluluwasmagsusunurannagbiyayanagtungoikinalulungkotfotospanghabambuhayibibigaysakopexhaustionleaders