Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "learning"

1. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

2. All these years, I have been learning and growing as a person.

3. All these years, I have been learning to appreciate the present moment and not take life for granted.

4. All these years, I have been making mistakes and learning from them.

5. Dedication to personal growth involves continuous learning and self-improvement.

6. Deep learning is a type of machine learning that uses neural networks with multiple layers to improve accuracy and efficiency.

7. Frustration can be a normal part of the learning process and can lead to personal growth and development.

8. I have been learning to play the piano for six months.

9. Many schools and universities now use television as a way to provide distance learning

10. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

11. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

12. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

13. She has been learning French for six months.

14. She is learning a new language.

15. She is not learning a new language currently.

16. The students admired their teacher's passion for teaching and learning.

17. The website has a lot of useful information for people interested in learning about history.

18. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

Random Sentences

1. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

2. Ang kahirapan ay isang laganap na suliranin sa ating bansa.

3. La creatividad nos permite pensar fuera de lo común y encontrar soluciones creativas a los desafíos que enfrentamos.

4. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

5. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

6. El arte abstracto tiene una simplicidad sublime que pocos pueden entender.

7. Hindi naman. Baka lang pagod ka na...

8. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

9. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

10. The detectives were investigating the crime scene to identify the culprit.

11. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

12. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

13. Hindi mo alam ang sagot sa tanong? Kung gayon, dapat kang mag-aral pa.

14. We admire the courage of our soldiers who serve our country.

15. Dahan dahan kong inangat yung phone

16. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

17. Puwedeng pautang, nanakawan kasi ako?

18. Ipapautang niya ang lahat ng pagkain at damit na bultu-bultong nakaimbak sa kanyang lalo pang pinalaking bodega.

19. Sana ay maabot ng langit ang iyong mga ngiti.

20. Cancer can impact individuals of all ages, races, and genders.

21. Sa panahon ngayon, napakahalaga ng mga taong bukas palad dahil sila ang nagbibigay ng pag-asa sa mga taong nangangailangan.

22. En af de mest synlige områder, hvor teknologi har gjort en stor forskel, er i elektronik

23. Bukod pa sa rito ay nagbigay pa ito ng bitamina sa katawan ng tao.

24. Lumingon ako para harapin si Kenji.

25. Musk is known for his ambitious goals and his willingness to take on seemingly impossible challenges.

26. Pasensya na, kailangan ko nang umalis.

27. Representatives participate in legislative processes, proposing and voting on laws and policies.

28. If you keep beating around the bush, we'll never get anywhere.

29. The police were trying to determine the culprit behind the burglary.

30. I'm sorry, I didn't see your name tag. May I know your name?

31. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

32. Nasa likuran lamang niya ang nagsalita.

33. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

34. Cultivar maíz puede ser un proceso emocionante y gratificante, con una buena planificación y cuidado, se puede obtener una cosecha abundante

35. Pangako ng prinsipe kay Mariang maganda.

36. Waring may bumisita sa bahay kagabi dahil bukas ang pintuan sa umaga.

37. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

38. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

39. May notebook ba sa ibabaw ng baul?

40. Los powerbanks suelen tener puertos USB que permiten conectar diferentes tipos de dispositivos.

41. Ibinigay niya ang bulaklak sa nanay.

42. Sudah makan? - Have you eaten yet?

43. Nakatingin siya sa nakasahod na balde ngunit ang naiisip niya'y ang bilin ng ina, na huwag na niyang papansinin si Ogor.

44. Waring hindi pa handa ang kanyang puso na magmahal muli.

45. Einstein was an accomplished violinist and often played music with friends and colleagues.

46. Los invernaderos permiten el cultivo de plantas en condiciones controladas durante todo el año.

47. Gusto ko sanang ligawan si Clara.

48. Tinuro ng coach kung paano kontrolin ang bola habang tumatakbo.

49. Habang nagluluto, nabigla siya nang biglang kumulo at sumabog ang kawali.

50. Hindi natin kara-karaka madadala ito nang walang ebidensya.

Recent Searches

continuedfourlearningsolidifyuponappdatingtelevisedhimgitanastig-bebeintejunjunsettingactoreffectsayawcallingryanulamoftendanskemahinahongnatuyouwakchristmaswifiimportantnakabilimagdidiskofacultyi-googlepasasalamatkalikasanpalabuy-laboypyestalumusobniyangfreelanceraseanlarawanmalalimpodcasts,masayanakalilipasstoryhinihintaykakayananipinambiliinintayminutehastamatigasaudio-visuallypangakolalakekumbentoiniisipplatomabaitdulotjuiceanimoywestbosesnaggingpaidmagaling-galingmagkaibabiocombustiblesikinakagalitmakauuwiespecializadaspalipat-lipattumatanglawnagtakapagkapasoknag-poutsulatbefolkningen,pagtawapagkasabimanggagalingbwahahahahahainilistauulaminnanunurinamatayhandaankinasisindakannaglokona-fundtulisanmagsisimulainisa-isanapahintofranciscopasaherojejukadalascualquiermamahalinkasamaankarangalangayunmankalarokirbynamilipitmaya-mayatutusinganapintinanggalpakibigyancynthiaflamencokatolikokumantacrecertelephonebutterflyherramientasnagplaysisentadisyemprelasaisinumpastreetmaubosnandiyantiyandespuesdialledheartbeatfollowediniintaynasankombinationwaiterupuanpamamahinganatagalanpinagkasundomamidisposalpopularmalamangsumasakitaffiliatebumigayenergipamimilhingdefinitivogapasthmakrusparomustbilaohumblebutchhinogumaagoslumulusobsinabibaryokatutuboyeplamanbusiness,espigasinomchildrenkatandaangrinsdreamattractiveabonojanefridayipanlinismalapadsilbingsanmagdanahulicontestsuchworryneroeeeehhhhreservationcongratssumalibilerchadelectionscigarettesdiliginicehatingpiniling