Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "papasa"

1. Papasa ka kung mag-aaral ka ng leksiyon mo.

Random Sentences

1. The detectives were investigating the crime scene to identify the culprit.

2. Regular exercise and playtime are important for a dog's physical and mental well-being.

3. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

4. Namnamin ang bawat minuto kasama ang iyong pamilya.

5. All these years, I have been striving to be the best version of myself.

6. A couple of friends are coming over for dinner tonight.

7. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

8. Sa pagpapakumbaba, maraming kaalaman ang natututunan.

9. Minsan lang ako nag mahal ng ganito.

10. Ewan ko apelyido pero basta Memo, kilala ka kasi nya eh.

11. Ang biograpo ay nagsusulat ng mga kwento ng buhay ng mga kilalang personalidad.

12. The patient's family history of high blood pressure increased his risk of developing the condition.

13. There's no place like home.

14. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

15. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

16. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

17. Los héroes son aquellos que demuestran una actitud valiente y una voluntad inquebrantable.

18. Palayo na nang palayo ang tunog ng kampana habang umuusad ang gabi.

19. Bakit di mo 'to sinabi sa akin?

20. The movie was absolutely captivating from beginning to end.

21. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

22. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

23. Marahil ay dapat kang mag-isip-isip muna bago magdesisyon sa mga bagay-bagay.

24. Ano ang palitan ng dolyar sa peso?

25. Ang tagpo ng nag-iisang bata sa lansangan ay nagdulot ng hinagpis sa aking damdamin.

26. Wer nicht wagt, der nicht gewinnt.

27. Umutang siya dahil wala siyang pera.

28. Nanood sina Pedro ng sine kahapon.

29. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

30. El internet ha hecho posible la creación y distribución de contenido en línea, como películas, música y libros.

31. may butil na rin ng pawis sa kanyang ilong.

32. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

33. Maramot siyang magpahiram ng kanyang mga libro dahil takot siyang masira ang mga ito.

34. Cada nacimiento es único y especial, con su propia historia y circunstancias.

35. ¡Muchas gracias!

36. The birds are not singing this morning.

37. The damage done to the environment by human activity is immeasurable.

38. Alles hat ein Ende, nur die Wurst hat zwei.

39. Nanlilimahid ang mga bata sa daan.

40. The team's colors are purple and gold, and they play their home games at the Staples Center.

41. Las redes sociales son una plataforma para compartir fotos y videos.

42. Pumasok sa sinehan ang mga manonood nang limahan.

43. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

44. Aba makulit ang matandang ito! Lumayas ka rito! Doon ka sumisid sa dagat.

45. Pumupunta siya sa Amerika taun-taon.

46. Magtaka ka na kung hindi pa sya umuuwi bukas.

47. Sasagot na sana ulit ako nang lumabas ng CR si Maico.

48. The model on the runway was a beautiful lady who effortlessly commanded attention.

49. Hinawakan ko siya sa may balikat niya.

50. Si Carlos Yulo ang naging inspirasyon sa pagbuhay muli ng gymnastics program sa Pilipinas.

Similar Words

napapasayanagpapasasaNapapasabaypagpapasakitpagpapasan

Recent Searches

herramientastraditionalandreapapasagumisingnaglabaibabawkanayangestadospaglayasbulongnandiyantanganpaggawanatitiraindependentlytodasheartbeatligaligwonderkinalimutanmasukolcityahhhhhimsourceslinggobilanginfriendbundokbagalrabbalalongself-defenseanghelmatayogmaisiplasanochekainisprosesouniversitiesairplanessiglosarasineknightdeletingfatherpinagtssstusindviskahusayanbinanggaarkilakatagalansacrificekinapanayamheardollybilinartsulam18761000rabecanadalawsdalawaccederamparoubodlandodemocracylingidtresinomlalabotanteeducationhugisbumabahakagandaleadinglarotakottaonmalapalasyomabutinanaigsinulidasiaticeasiercongratsjackyreservedknowsschoolsmajorconvertidasmatindingdaysbarriersjokerelolegendsnapagsilbihanadditionallynaroonipinatomsedentaryiniselectionneroconcernsstudentsagingfonopedeochandothreeinfinitynutsinteligenteseditorayanfullworkdayconditioningcirclepuntabringbabepagsagotputinginsteadsourcecomputerstartedmethodscontinueformsdulowindowtabaablesolidifygradcryptocurrency:culturekommunikererdevelopbatanginiresetamakapagsabitutorialsitinakdangkaraokefamilypagkakalutocaracterizalalawigannag-iinommamayajuanitosinabibakantecementmalumbaypinangalanansana-allresearch,mariangagandapaksakamandagcornerspupuntatechniquesbalatmaaaringisipniztradebabalikhoundnapahintopresleykakayurinpagdudugoconnectingbobotonakataasaraw-addressbakuranmabaliktabiiniirog