Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "bill"

1. She was already feeling overwhelmed, and then she received a massive bill in the mail. That added insult to injury.

2. The restaurant bill came out to a hefty sum.

3. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

Random Sentences

1. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

2. The news might be biased, so take it with a grain of salt and do your own research.

3. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

4. Twinkle, twinkle, little star.

5. Inflation kann auch durch eine Verringerung der Produktion verursacht werden.

6. Hindi ko na kayang itago ito - sana pwede ba kita ligawan?

7. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

8. Frustration can be a normal part of the learning process and can lead to personal growth and development.

9. Masayang-masaya ang kagubatan.

10. Pneumonia can be life-threatening if not treated promptly.

11. Ngunit sa lahat, siya ang may pinakalutang na kagandahan.

12. Pumasok sa sinehan ang mga manonood nang limahan.

13. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

14. Les maladies chroniques telles que l'asthme, l'arthrite et le syndrome de fatigue chronique peuvent affecter la qualité de vie d'une personne.

15. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

16. The telephone has undergone many changes and improvements since its invention

17. Working can provide a sense of purpose, achievement, and fulfillment.

18. Einstein was known for his sense of humor and his love of sailing.

19. Fui a la fiesta de cumpleaños de mi amigo y me divertí mucho.

20. Nationalism can also lead to authoritarianism and repression of dissent.

21. Sa labas ng bintana, natatanaw ko ang mga batang naglalaro sa kalye.

22. Marami nang nakapaligid sa kanila, mga batang nagtitinda, lalaki at babaing mamimili.

23. Nakipag bahay-bahayan kay Athena.

24. Nag-asaran, naglokohan at nagtawanan sila.

25. Ang mga magsasaka ay nagtatanim ng palay.

26. I am absolutely confident in my ability to succeed.

27. El aloe vera es una hierba medicinal conocida por sus propiedades curativas para la piel.

28. Ang Ibong Adarna ay kinikilala bilang isa sa mga pinakamahalagang kwento sa panitikang Filipino.

29. Ang kakahuyan sa bundok ay mayabong at puno ng iba't ibang mga uri ng mga halaman.

30. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

31. Erfaring har lært mig at tage ansvar og være proaktiv.

32. Pinakain ni Rose si Mrs. Marchant ng almusal.

33. The king's role is to represent his country and people, and to provide leadership and guidance.

34. Nanalo si Lito sa pagka gobernador ng kanilang lugar.

35. El conflicto entre los dos países produjo tensiones en toda la región.

36. Limitations can be financial, such as a lack of resources to pursue education or travel.

37. Dapat bigyang pansin ang kawalan ng seguridad sa trabaho ng mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

38. Mommy. ani Maico habang humihingal pa.

39. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

40. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

41. Ngayon lang ako nag mahal ng ganito.

42. The stock market gained momentum after the announcement of the new product.

43. I know this project is difficult, but we have to keep working hard - no pain, no gain.

44. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

45. Don't beat around the bush with me. I know what you're trying to say.

46. Owning a pet can provide companionship and improve mental health.

47. Mahalaga ang papel ng mga organisasyon ng anak-pawis sa pagtitiyak ng kanilang mga karapatan.

48. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

49. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

50. Electric cars have lower maintenance costs as they have fewer moving parts than gasoline-powered cars.

Similar Words

multi-billion

Recent Searches

nuonbillsumusunosteveuridatiwatchlabahinnilutochangeconsideredmapakalikakaibangsambitleadpreviouslyrelievedginawamasayanghiningamedikalsahodnakapangasawasinunggabanbeautystocksmatagalnaghanapmagbasavisuallamankaagawsaranggolanagtatrabahonaulinigananimoypagkalipaskaano-anoaggressionilanlangyakaininimportantedetmakuhalingidhagdananmaintindihankapamilyasasabihinmensajestandanglotconsumebalotnagkasakithandaanproducesinisiranaglaonnasaanggobernadormagpa-ospitaldrawingbumibilipagpapatubomakapangyarihannapakatagalunattendednagpakunotnagdiretsotalinoadgangkinumutansumusulattungkodisinuotbutikiitinatapatattorneypapuntangpinabulaanna-curioushalikinvitationhikingmartialsuwailphilosophicalpinatiragalaanmasungitcoloursciencedaykwebaisaacargueparinamprimersaansearchlovejennypasyaofficepuededagakirotumiinitmanuelsusunduinespadapangangailanganwritechefbalingdakilanginuminmayroongmakikipag-duetobanallabananpeterborgeredagokgooglehalinglingsarongpagsasalitapaksawordnagtatanongpaghabaimportantpagbabagong-anyodatalumbaymaunawaanbirthdaydiscipliner,research,kaninavitaminngunitpinalambotsemillasdinmagkasakitbanlagvelfungerendesementoperseverance,malawaksenatenamumulanahahalinhanumagawlot,matindinakatiramakasilonglumiwagpamahalaannag-aalangantiniradorkalakihannaka-smirkmagkaibiganpamilyamananalopinapatapossinaliksikpagsagotmagtakanaiilangnapatulalamangyariniyognabuhaymatagumpayfranciscowaitersabogracialkabarkadashoppingtablebinyagangnapatingalamakasarilinglettermustkasingtigasprusisyonadditionallynatatakotwingbiggest