Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

30 sentences found for "basketball"

1. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

2. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

3. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

4. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

5. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

6. Basketball is a team sport that originated in the United States in the late 1800s.

7. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

8. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

9. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

10. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

11. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

12. Bumili si Pedro ng bagong bola para sa kanilang basketball game.

13. He has been practicing basketball for hours.

14. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

15. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

16. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

17. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

18. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

19. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

20. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

21. Naglaro sina Paul ng basketball.

22. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

23. The basketball court is divided into two halves, with each team playing offense and defense alternately.

24. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

25. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

26. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

27. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

28. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

29. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

30. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

Random Sentences

1. Hawak ang tirador ay sinaliksik ni Kiko ang buong paligid.

2. Håbet om at finde kærlighed og lykke kan motivere os til at søge nye relationer.

3. Paano ako pupunta sa Intramuros?

4. Hindi ako pumapayag sa kanilang plano dahil nakikita kong mayroong mga posibleng panganib na maaring maganap.

5. Inakalang nanalo siya sa laro, pero may mas mataas pa palang puntos ang kalaban.

6. Advances in medicine have also had a significant impact on society

7. Nagtataka ako kung bakit hindi mo na ako tinutulungan tulad ng dati.

8. Mag-aaral ako sa unibersidad sa susunod na taon.

9. Lights the traveler in the dark.

10. The company's CEO announced plans to acquire more assets in the coming years.

11. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

12. Der er ingen fastlagte regler for, hvordan man bliver kvinde, det er en individuel proces.

13. Buksan ang puso at isipan.

14. El agua tiene propiedades únicas, como la capacidad de disolver sustancias y regular la temperatura.

15. Halos de-lata na lang ang lagi nitong inuulam.

16. Pasensya na, kailangan ko nang umalis.

17. Ang mga bayani ay nagbibigay inspirasyon sa mga kabataan upang maging mabuting mamamayan.

18. Nanghahapdi at waring nasusunog ang kanyang balat.

19. Tumalikod siya bigla saka pumasok sa kwarto niya.

20. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

21. Huwag daw niyang papansinin si Ogor.

22. Aksidente naming nabasag ang isang plato habang naglilinis ng kusina.

23. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

24. Sa droga, walang nagwawagi kundi ang tao mismo.

25. The Getty Center and the Los Angeles County Museum of Art (LACMA) are renowned art institutions in the city.

26. Eine schlechte Gewissensentscheidung kann zu Konflikten und Schwierigkeiten führen.

27. I can tell you're beating around the bush because you're not looking me in the eye.

28. Negative self-talk and self-blame can make feelings of frustration worse.

29. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

30. El aloe vera es una hierba medicinal conocida por sus propiedades curativas para la piel.

31. Ang tunay na pag-ibig sa bayan, ay sa sariling wika nagsisimula.

32. Sa paggamit ng mga kagamitan, huwag magpabaya sa tamang pag-aalaga at pagpapanatili nito.

33. **You've got one text message**

34. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

35. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

36. Sa harap ng kahirapan, ang mga mahihirap ay nag-aapuhap ng tulong mula sa mga non-profit organizations.

37. Monas di Jakarta adalah landmark terkenal Indonesia yang menjadi ikon kota Jakarta.

38. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

39. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng tamang pag-iisip, kaalaman, at tiyaga.

40. I am not planning my vacation currently.

41. Siya ay nangahas na mag-apply sa isang prestihiyosong unibersidad kahit mababa ang kanyang kumpiyansa.

42. May bumisita umano sa bahay nila kagabi ngunit hindi nila nakita kung sino.

43. Andrew Jackson, the seventh president of the United States, served from 1829 to 1837 and was known for his expansion of democracy and his controversial policies towards Native Americans.

44. Ang kanyang kwento ay hitik sa mga magagandang detalye at makulay na karakter.

45. Naging masaya ang aking buhay dahil sa aking mga kaulayaw.

46. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

47. Nag-aaral tayo ng Tagalog ngayon.

48.

49. Elon Musk is a billionaire entrepreneur and business magnate.

50. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

Recent Searches

basketballnakapagproposehinanapanihinparurusahankasalanansumingitbarabasnizamericanparehasmachinestulalaganakinseokaywidelydiyospolospecialrailwaysbranchreplaceddaangactingmapuputitanimmuchasplatformsemphasisidea:sulinganochandovisualtechnologiesrepresentedviewsyonnagkitamagasawangkahaponrevolutioneretpaghihingalodadalawinmagpagalingmananakawnaguguluhankatuwaanmauliniganmakikitulogpagamutanuulaminmangahasnapatigilkamandagkumampiumagawmaghapontabingeleksyontatlopagmasdanpigingginaganoonkaugnayantibigbigyannag-replymarumidibailocossanhangaringzooiiklilalabhanmabalikhighfuncionesmodernpollutionbroadcastsgitnadarksquatterpakitimplajoysagingmentalsinaliksikmakenangagsipagkantahannaglipanangnaglalarokagalakansasagutinhellokondisyonkisstaglagasperyahankabiyaknakangisinggovernorssusunodpag-aaniwantmarangalpaglayasnakabiladpagpasokpa-dayagonalsalatinpaggawatresmalapitanroselleginawangloanslatedayspedenginteligentessetsrepresentativecountlessworkcleanawang-awaumiinompaki-drawingmahuhusaypangungutyakinikitamanahimikmahinapaghanganalagutanngayoniiwasanumiibigpaanonatutuwabalikattmicapinatawadpnilitiyonghinampasbutitomorrowsadyangkasocapacidadcarriesaaisshfiabeganopomahahabahanbobosaringetotrainingpinunitoftemalezanapatawagfotoshampaslupatumawagpagtawastrategieskaklasewatawatpopulationstyleculturekampeonpicturespagongpantalonligaligpadalastalagangknightsabogkulisapbotantekruschoiipagamotmenossystematisksamameetcafeteriacasesaware