Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

30 sentences found for "basketball"

1. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

2. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

3. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

4. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

5. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

6. Basketball is a team sport that originated in the United States in the late 1800s.

7. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

8. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

9. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

10. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

11. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

12. Bumili si Pedro ng bagong bola para sa kanilang basketball game.

13. He has been practicing basketball for hours.

14. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

15. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

16. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

17. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

18. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

19. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

20. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

21. Naglaro sina Paul ng basketball.

22. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

23. The basketball court is divided into two halves, with each team playing offense and defense alternately.

24. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

25. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

26. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

27. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

28. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

29. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

30. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

Random Sentences

1. He's always telling tall tales, so take his stories with a grain of salt.

2. Gusto naming makita uli si Baby Janna eh. si Maico.

3. I am not enjoying the cold weather.

4. Ang mga kabayanihan ng mga sundalo at pulis ay kailangan ituring at kilalanin bilang mga halimbawa ng tapang at dedikasyon.

5. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

6. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

7. He has been practicing yoga for years.

8. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

9. Les maladies infectieuses telles que le VIH/SIDA, la tuberculose et la grippe peuvent être prévenues grâce à une bonne hygiène et des vaccinations.

10. Ang puting pusa ang nasa sala.

11. The dedication of mentors and role models can positively influence and shape the lives of others.

12. Sa paligsahan, pumasok sa entablado ang mga kalahok nang limahan.

13. She has won a prestigious award.

14. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

15. Emphasis can be used to create rhythm and cadence in language.

16. Naglakad ang bata papuntang eskuwelahan.

17. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

18. ¿Cuándo es tu cumpleaños?

19. Sa pagkain ng pulotgata, mahalaga na maghugas ng kamay upang hindi magkalat ang tamis sa ibang bagay.

20. The garden boasts a variety of flowers, including roses and lilies.

21. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

22. Ang bayanihan ay nagpapalakas ng samahan at pagkakaisa sa aming pamayanan.

23. Kebahagiaan juga dapat ditemukan dalam pengembangan diri, seperti belajar hal baru atau mengejar hobi yang disukai.

24. Hinawakan niya iyon sa magkabilang tirante.

25. Ang pagpapakain ng mais sa tamang oras at pag-alaga sa mga halaman ay magbibigay sa iyo ng masaganang ani

26. Det er også værd at bemærke, at teknologi har haft en stor indvirkning på vores samfund og kultur

27. Boboto ako sa darating na halalan.

28. Pumunta kami kahapon sa department store.

29. Naglipana ang mga batang naglalaro sa parke ngayong Linggo.

30. Bumalik siya sa lugar ng aksidente at tulala sa nangyari.

31. Anong nginingisi ngisi mo dyan! May balak ka eh! Ano yun?!

32. Maaari ring magdulot ng agam-agam ang pagbabago sa buhay tulad ng paglipat sa ibang lugar o pagbabago ng trabaho.

33. Las plantas desempeñan un papel fundamental en el ciclo del agua, absorbiéndola del suelo y liberándola a través de la transpiración.

34. Malalaki ang ahas na nakakulong sa zoo.

35. Oh gosh. Inintay pa sya ng prince, what does it mean?

36. Les étudiants doivent respecter les règles de conduite à l'école.

37. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

38. She carefully layered the cake with alternating flavors of chocolate and vanilla.

39. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

40. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

41. The store offers a variety of products to suit different needs and preferences.

42. Hawak nito ang isang maliit na bangos na tig-bebente, sa loob-loob ni Aling Marta.

43. Sa pagguhit, mahalaga ang pagpili ng tamang anggulo at perspektiba.

44. Di na natuto.

45. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

46. Nanghiram ako ng bicycle para sa isang bike race.

47. Sa matinding takot ay nagsunuran ang mga mangingisda sa di nila nakikilalang matanda.

48. Waring may nais siyang sabihin, ngunit pinili niyang manahimik.

49. Ilang kilo ng pinya ang binili niya?

50. Saka dalawang hotdog na rin Miss. si Maico.

Recent Searches

basketballmaglutopaanongipinikitwednesdayyarisaritanagsmileproductividadmabibingiescuelashinintaypakiramdambabeipapainitpalakapesodiagnosticallowingtumahanvidtstraktmasaholtumalimnagyayangfireworkssulinganmakakakaennapahintokaparehamulkumbentosakalingsolidifydesarrollarmakapilingcomplexintelligencekakayananpulislutoandoyhoneymoonnagagandahanmantikaliablemabutipinangalanangkatawangnakadapamahahalikkatutubonapaluhamataaaskumainsabongnoonespecializadasconsiderisinaboylumilipadpinilingmakausapsumingitdefinitivopananglawmaalwangamerikabisitaartistaspaungolhinatidnasasabihanheartbreaksadyangpaglulutodilawlabanannakahainharpinapakingganmagmulaguitarranalugodempresasmakaipondisappointpiratapagsalakayreynaninyonglacsamanaopotapetatlongabut-abotmakabawibaguioipinambiliemailnaiinggitemphasizedlupainasignaturamagsimulapatongmagdaraoskumatokpumilimananahinahihiyangawitinganitomariahoybumibitiwpagbibironapapikittruenagbasaambagdiferenteshurtigerenalalamanpagtataashousebusiness,andrealigaligasiaticika-50nagmistulangsikipsumapitminahanbotantejoeknightnawalahampaslupamagselosna-suwaykamakailanindividualcandidateskasinakalagaynangahasnochekombinationmeetgagambamagkapatidmaipantawid-gutomlamanbalinganlalabhanterminokinalakihanprobablementeresumenlarongnaglalatangmatulunginpag-uwit-shirtkailanmanmeansjocelynpamilihankapeteryamind:nagpakilalaclientsnapapahintomatabamasksilbingtumakasmisyunerobefolkningen,pusasay,gagawinpangyayaringferrereyenakapagngangalitporampliaprincipalesinintaynagpagupitlabisstarnaiinitankabutihansumisidipinamiligratificante,taga-ochando