Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

30 sentences found for "basketball"

1. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

2. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

3. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

4. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

5. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

6. Basketball is a team sport that originated in the United States in the late 1800s.

7. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

8. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

9. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

10. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

11. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

12. Bumili si Pedro ng bagong bola para sa kanilang basketball game.

13. He has been practicing basketball for hours.

14. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

15. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

16. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

17. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

18. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

19. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

20. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

21. Naglaro sina Paul ng basketball.

22. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

23. The basketball court is divided into two halves, with each team playing offense and defense alternately.

24. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

25. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

26. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

27. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

28. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

29. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

30. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

Random Sentences

1. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

2. Oo naman! Idol ko si spongebob eh.

3. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

4. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

5. Maraming mga anak-pawis ang hindi makatugon sa kanilang mga pangangailangan dahil sa kakulangan ng oportunidad.

6. Los héroes pueden ser encontrados en diferentes campos, como el deporte, la ciencia, el arte o el servicio público.

7. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

8. Hindi maganda na maging sobrang matakot sa buhay dahil sa agam-agam.

9. Sa mga nagdaang taon, yumabong ang mga proyekto para sa kalikasan at kabuhayan ng mga tao.

10. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

11. Magandang araw, sana pwede ba kita makilala?

12. Ayoko na pong maging pabigat sa kanila.

13. Padalas nang padalas ang mga nawawala kaya't lumapit ang taong bayan sa kanilang makisig na hari upang humingi ng tulong.

14. Oo nga babes, kami na lang bahala..

15. Ngunit nagulat ang lahat sapagkat mul sa maruming ilog ay may maliliit na insektong lumulusob sa bayan tuwing gabi.

16. Nagliliyab ang kandila sa altar habang nagsasagawa ng dasal.

17. El que ríe último, ríe mejor.

18. Batang-bata ka pa at marami ka pang kailangang malaman at intindihin sa mundo.

19. Limitations can be self-imposed or imposed by others.

20. Ang mailap na mga bagay ay kailangan paglaanan ng oras at pagsisikap upang makamit.

21. A king is a male monarch who rules a kingdom or a sovereign state.

22. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

23. Mayroon akong ibang mungkahi at ito ay ang dahilan kung bakit ako tumututol sa kanilang panukala.

24. Sumigaw siya ng "sandali lang!" ngunit patuloy itong naglakad palayo.

25. Las serpientes son carnívoras y se alimentan principalmente de roedores, aves y otros reptiles.

26. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

27. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

28. Ang kaniyang dugo ay nakakagaling ng mga sakit.

29. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

30. Kailangan mong umintindi ng kaibuturan ng kanyang pagkatao upang magkaroon kayo ng mas malalim na ugnayan.

31. Ang aking kabiyak ay palaging nasa tabi ko sa hirap at ginhawa.

32. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

33. Wedding planning can be a stressful but exciting time for the couple and their families.

34. Nung natapos yung pag print, nakita nung babae yung pictures.

35. Wow, talaga? Para kayong vampires, sa gabi nabubuhay.

36. Sa muling pagkikita!

37. Pahiram naman ng dami na isusuot.

38. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

39. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

40. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

41. El ciclo del agua es un proceso natural que involucra evaporación, condensación y precipitación.

42. Don't waste your money on that souvenir, they're a dime a dozen in the market.

43. Ano hong klaseng sawsawan ang gusto ninyo?

44. Anong oras ho ang dating ng jeep?

45. Samvittigheden kan være en påmindelse om vores personlige værdier og moralske standarder.

46. Hinimas-himas niya yung likod ko pagkalapit niya saken.

47. Nagtatrabaho ako sa Youth Center.

48. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

49. The sun sets in the evening.

50. Sa pag-alis niya sa tahanan, nag-iwan siya ng mga alaala at mga kuwentong puno ng pagmamahal.

Recent Searches

basketballmakatidrawingafternoonisasamakutsilyoparoroonanahulaansmilebagamamagsaingaregladobumangondialledbulongshoppingindependentlystocksyunahaspondokasamamasipagnatinmaalwangsurroundingsipinamilipelikulaalakerapandrewnagtuloymaintindihanbuntisindiapriestbasahincassandralandmalambingapoyilocoskarangalanmalumbaydalagangnagnoonumiimikhanginsenateisipkainrailwaysmassesproductionseriouspalagitransmitidasbiglatilldiagnosesopgaver,asullimoschavitwatchingbutikimandukotcontent,maskclasesdinalawminutocarerabecivilizationramdamsoonproveasinfreelancerformasrisknitongstarbugtongwideibalikpagbahingforcesformsgrupoexpertisetsakalineexperiencesisamalabopedebelldontfatbruceeeeehhhhreservationcoatcoaching:rolecomunesplatformsdonvasquesinalokcommunicationsworlddeleelectioncomeagoskumarimotventafredsafejunionasundobaldeinilinglimityondiscipliner,umilingartificialfilmmobilenagkakakainanihinsantopasinghaltechnologicalawarebetahulingtechnologiesrecenttobaccodeclarekahulugancommunicateclientesfacehotelechavereadingkumakapitkabundukandulopinalambotbitbitpacesalatinlabingkapangyarihangspendingkaragatan,humigit-kumulangnagwelgaitinalagang1973ikinakagalitmagkikitanakauponagsulputanpinunitlumabasde-lataitinatapatumagangerlindaleadersginamitinakalangincluiragawnagpatulongsilid-aralanpublishing,paakyatotherkakayananvissaronginiintaybutterflyiyaktindahannamapinapasayaofrecenpamamahingapagpasok