Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

30 sentences found for "basketball"

1. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

2. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

3. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

4. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

5. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

6. Basketball is a team sport that originated in the United States in the late 1800s.

7. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

8. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

9. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

10. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

11. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

12. Bumili si Pedro ng bagong bola para sa kanilang basketball game.

13. He has been practicing basketball for hours.

14. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

15. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

16. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

17. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

18. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

19. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

20. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

21. Naglaro sina Paul ng basketball.

22. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

23. The basketball court is divided into two halves, with each team playing offense and defense alternately.

24. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

25. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

26. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

27. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

28. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

29. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

30. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

Random Sentences

1. Waring may bumisita sa bahay kagabi dahil bukas ang pintuan sa umaga.

2. Les hôpitaux peuvent être surchargés en période de crise sanitaire.

3. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

4. Halos maghalinghing na siya sa sobrang pagod.

5. Kay hapdi ng kanyang batok at balikat.

6. Maraming mga tao ang nakatambay pa rin sa mga tindahan sa hatinggabi.

7. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

8. Walang kagatol gatol na sinagot ni Juan ang tanong ng kanyang teacher.

9. Las fiestas invernales, como el Día de Reyes, traen alegría y celebraciones.

10. Ang nagtutulungan, nagtatagumpay.

11. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

12. Naiinlove ako nang lubusan sa aking nililigawan dahil napakasaya ko tuwing kasama ko siya.

13. Hindi dapat tayo magbulag-bulagan sa mga insidente ng abuso sa ating paligid.

14. Sa pamamagitan ng pagkuha ng mahusay na tulog, ang aking pagkapagod ay napawi at nagkaroon ako ng sariwang enerhiya.

15. Robert Downey Jr. gained worldwide recognition for his portrayal of Iron Man in the Marvel Cinematic Universe.

16. Nagpipiknik ang pamilya namin kung maaraw.

17. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

18. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

19. Hiram lamang natin ang ating buhay sa Diyos.

20. Nagliliyab ang puso ni Andres sa pagmamahal para sa kanyang pamilya.

21. Gusto kong malaman mo na may ganitong pakiramdam ako, kaya sana pwede ba kita ligawan?

22. Di ko sya maistorbo dahil sya ay nag-aaral pa.

23. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

24. Lumayo siya sa amin, waring nais niyang mapag-isa.

25. Ang tamis ng pulotgata ay nagbibigay sa akin ng energy para magpatuloy sa araw.

26. ¿Cómo te va?

27. Napakabagal ng proseso ng pagbabayad ng buwis, animoy lakad pagong.

28. Ilang tao ang nagsidalo sa graduation mo?

29. The construction of the building required a hefty investment, but it was worth it in the end.

30. Las heridas profundas o que no dejan de sangrar deben ser evaluadas por un profesional médico.

31. Kung hindi siya maramot, baka mas marami ang natulungan niya.

32. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

33. Ang Ibong Adarna ay patuloy na nakakaakit ng mga mambabasa sa ngayon dahil sa kanyang pagpapakita ng kagandahan ng kultura at panitikan ng Pilipinas.

34. Malaki ang kanilang rest house sa Tagaytay.

35. I am not listening to music right now.

36. People can also borrow money through loans, credit cards, and other forms of debt.

37. Totoo nga! Sa ilalim niyon nakabaon ang gong na susi ng kanilang kasaganaan.

38. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

39. Sariling pagraranas ang aking pamamagitan.

40. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

41. Okay na ako, pero masakit pa rin.

42. Dahil sa bayanihan, naging matagumpay ang aming pagtatanim ng mga pananim sa taniman.

43. Jodie at Robin ang pangalan nila.

44. Para poder cosechar la uva a tiempo, debemos empezar con la vendimia en septiembre.

45. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

46. At tilgive os selv og andre kan være afgørende for at have en sund samvittighed.

47. Pagkagising ni Leah ay agad na itong naghilamos ng kanyang mukha.

48. La calidad y la frescura de los productos agrícolas dependen en gran medida de la habilidad y la dedicación del agricultor.

49. Sate adalah makanan yang terdiri dari potongan daging yang ditusuk pada bambu dan dibakar dengan bumbu kacang.

50. Mahilig sya manood ng mga tutorials sa youtube.

Recent Searches

basketballsalaalldumeretsoitoskypangyayarinapakaalas-diyesmakainoperatekaramdamanplasasigipabibilanggoreservespinakamahabanewsikinasuklamlittlemaabutannasuklamsobrangmendiolamagsainggalingvictorianapalitangnakabibingingnagdaraanpumapasoknaniwalaadvancementactoraralbrieft-ibanginangkinatatayuankidlatmakalingsumangmagpapalitinakyatpagmamanehotilaprivategasolinaaddnamanwednesdaykanikanilangpinangyarihanaffectcancerkabuntisanvirksomhederzebraumutangfranciscowalanghabitmarketplacesunalawarestmadungisbilindonpagpiliprogramsegenagadkalaunannag-iisippunongkahoypaghusayansagabalnahulifeltpinigilanpagngitihawakkanya-kanyangbrucemanatilisacrificefiancehanginlivenahihirapanclimbedyumaoemphasisgiriswayownhalamanstartnamumutladescargarspeechesunibersidadsinungalingnagitlalalakigutommusiciansumisidlasmusicfarelectronicmasaraprambutannaputolpaglayascareernasisilawcomebokmotiontulisanomelettebigassakimmayabangmaluwangsuotarawnilinislumbaylamangcrazylookedtenerpagkaganda-gandaexamplekainaabsentmagpahababorniyongnewtumatawamamalasmalisanhabangkatutubouugod-ugodnagplaymag-isakayakailanmanlotsanangasamaratingtoretedeteriorateprincenaghandangcomputerlupangworkshoppangaraptipspaskonggenerositypaungoltakeaniyapagsisisinagbaliknapagtuunannakiramaylangnakapagngangalitslavedapatdancenasaasukalseparationforstålandbrug,husomakikitulogemphasizeditaaskawili-wilimaynilaatbiyayangmamanhikanhitsuradaliriguerrero1990seniorilalim