Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

31 sentences found for "technology"

1. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

2. Amazon is an American multinational technology company.

3. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

4. Confocal microscopes use laser technology to create 3D images of small structures.

5. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

6. Despite the many advancements in television technology, there are also concerns about the effects of television on society

7. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

8. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

9. From its early days as a technology for the elite, to its current status as a staple in most

10. However, there are also concerns about the impact of technology on society

11. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

12. In recent years, television technology has continued to evolve and improve

13. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

14. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

15. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

16. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

17. Technology has also had a significant impact on the way we work

18. Technology has also played a vital role in the field of education

19. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

20. Television is one of the many wonders of modern science and technology.

21. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

22. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

23. The company used the acquired assets to upgrade its technology.

24. The field of entertainment has also been greatly impacted by technology

25. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

26. The nature of work has evolved over time, with advances in technology and changes in the economy.

27. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

28. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

29. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

30. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

31. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

Random Sentences

1. Mamaya na lang ako iigib uli.

2. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

3. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

4. Inflation kann auch durch eine Erhöhung der Nachfrage nach bestimmten Waren und Dienstleistungen verursacht werden.

5. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

6. Ang mga estudyante ay sumailalim sa isang pagpupulong upang magbahagi ng kanilang mga mungkahi sa paaralan.

7. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

8. Protecting the environment requires a collective effort from individuals, organizations, and governments.

9. Ehehe. Siya yung boyfriend ko.

10. Isang mahigpit na tunggalian ang naganap sa gitna ng kabanata, na nagbigay daan sa pagbabago ng landasin ng kuwento.

11. Sa ganang iyo, dapat bang palakasin pa ang kampanya laban sa fake news?

12. Bakasyon ko na sa susunod na buwan.

13. Ibinigay niya ang kanyang pag-ibig at suporta sa gitna ng mga pagsubok.

14. Wer nicht wagt, der nicht gewinnt.

15.

16. Naku, wala ka naming gagawin sa Davao.

17. Ang digmaan ay maaaring magdulot ng pagbabago sa pamamahala ng isang bansa.

18. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

19. Not only did he crash my car, but he also tried to blame me for it. That just added insult to injury.

20. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

21. Algunos fines de semana voy al campo a hacer senderismo, mi pasatiempo favorito.

22. The church organized a charitable drive to distribute food to the homeless.

23. Maraming bayani ang nagawa ng mga bagay na imposible sa panahon ng kanilang panahon.

24. La esperanza y los sueños son una parte importante de la vida. (Hope and dreams are an important part of life.)

25. At sa paglipas ng panahon, naging malakas na ang lalaki na nakilala nilang Damaso.

26. La poesía de Neruda tiene una elegancia sublime que conmueve al lector.

27. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

28. Nagsagawa ng ritwal si Matesa upang sumpain ang anak ng mag-asawa.

29. Ngunit parang walang puso ang higante.

30. Isang araw ay umuwi si Ana sa kaniyang magulang niya.

31. Kanina pa siya ganyan kuya.. parang ang lalim ng iniisip.

32. He has written a novel.

33. Saan ka galing? Dalawang araw na ako dito ah! aniya.

34. Mencapai tujuan dan meraih kesuksesan dapat memberikan perasaan kebahagiaan yang mendalam.

35. Las personas pobres son más vulnerables a la violencia y la delincuencia.

36. Nakalimutan ko na biglaang may appointment ako kanina kaya hindi ako nakapunta.

37. Sa pagsasaayos ng aming barangay hall, nagkaroon kami ng malaking tagumpay dahil sa bayanihan ng mga residente.

38. Det har ændret måden, vi interagerer med hinanden og øget vores evne til at dele og få adgang til information

39. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

40. Sa isang malayong pook sa Pilipinas nakatira ang mag-asawang sina Mang Kandoy at Aling Pising.

41. Sa bawat panaghoy ng mga nagugutom, pilit nilang itinataguyod ang kanilang pamilya.

42. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

43. Sa mga kasal, kadalasan ay mayroong pagbibigay ng regalo sa mga panauhin bilang pasasalamat sa pagdalo.

44. Inakalang madali lang ang gawain, pero ito’y masalimuot pala.

45. Dahil sa pagtatapos ng isang mahabang relasyon, siya ay puno ng lungkot at panghihinayang.

46. Nagpapadalhan na kami ng mga mensahe araw-araw dahil nililigawan ko siya.

47. Saan ako nag-aaral ng kindergarten?

48. En god samvittighed kan være en kilde til personlig styrke og selvtillid.

49. Nagtitinda ang tindera ng mga prutas.

50. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

Recent Searches

technologystopincreasealignsactivityfullpagkamanghanagpatuloyganyangulathouseholdskaniyahulutumatawagpoorernanunurimovingbayadmapagkalingadialledmusicalesnakilalanalangkulturinulitiniintaynaabotnenalending:proyektomensahepoliticsadditionallystoryerrors,conditiongapsundaeipantalopbairdnausalsurgerykwebangwideipinasyangcoalganidwaterscientistactualidadnagsasagotmangangahoymagagawabawianmagtatanimnagbibirokapwanakitangmabilisayusininastacashgjortmusicianssorryarmaelcausesngititrapikpancit1973studiedryanitemsinformedpantalongnaghihirapnaghihinagpismagsugalkasamaangricaestarskillsasoonlinepinakamatunogisinulatnagliliyabcomputermagpagalingdadalogovernmentpahahanapdeliciosawriting,kastilangmagisipngaresultabarongkargahannariyankalongaumentarnaisipanlinismalapadmagpuntanapakahabaoliviafridaywalispumikitgayunpamanstuffedpagbahingphysicalconsiderplansimplengchesssellpaperanubayannalulungkotyumabongkundinagpabayadmakikikainnagaganapkangkonguugod-ugodngumiwiabanaiiritangintindihinbinilidemocratictig-bebeintelittlegownbinanggacareanihinviewslaterkalaunangandaparkingsumagotreguleringseniorinantaypanopopularyatamagnifynahigakatagamaingatmayamansinunodteacherumakyatnooamparomodernefiaburmanumerosasomgtapatnakapuntatrescapitalitinagoabriluwakvaccinesnatatawaautomatiskkagubatannamumulamanilbihanusuarionagtataenapatigilipinatawagmagpapigilmagpasalamattahanandesisyonanmagpa-checkupmakapangyarihangwalkie-talkiepinagsikapannagkitakomunikasyonnagkakatipun-tiponikinagagalak