Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

31 sentences found for "technology"

1. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

2. Amazon is an American multinational technology company.

3. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

4. Confocal microscopes use laser technology to create 3D images of small structures.

5. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

6. Despite the many advancements in television technology, there are also concerns about the effects of television on society

7. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

8. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

9. From its early days as a technology for the elite, to its current status as a staple in most

10. However, there are also concerns about the impact of technology on society

11. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

12. In recent years, television technology has continued to evolve and improve

13. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

14. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

15. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

16. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

17. Technology has also had a significant impact on the way we work

18. Technology has also played a vital role in the field of education

19. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

20. Television is one of the many wonders of modern science and technology.

21. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

22. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

23. The company used the acquired assets to upgrade its technology.

24. The field of entertainment has also been greatly impacted by technology

25. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

26. The nature of work has evolved over time, with advances in technology and changes in the economy.

27. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

28. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

29. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

30. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

31. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

Random Sentences

1. Mabilis ang takbo ng pelikula.

2. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

3. Marmaing sandaling walang nangahas magsalita.

4. Bahay ho na may dalawang palapag.

5. Det er også værd at bemærke, at teknologi har haft en stor indvirkning på vores samfund og kultur

6. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

7. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

8. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

9. Nangahas siyang sumagot sa guro nang hindi nag-iisip, kaya siya napagalitan.

10. Le travail est une partie importante de la vie adulte.

11. Basketball is a team sport that originated in the United States in the late 1800s.

12. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

13. Ojos que no ven, corazón que no siente.

14. Mahirap kausapin ang mga taong maarte dahil sa kanilang pagiging kritikal sa bawat bagay.

15. Mas maliit ang bag ko sa bag ni Cassandra.

16. Na-promote ako sa higher position sa aking company kaya masayang-masaya ako ngayon.

17. Ang mga palaisipan ay maaaring nagdudulot ng pag-unlad sa mga larangan tulad ng agham, teknolohiya, at sining.

18. Iyong pakakatandaan na ikaw lamang ang aking iniibig.

19. Nationalism has played a significant role in many historical events, including the two World Wars.

20. The baby is sleeping in the crib.

21. Magkano po sa inyo ang yelo?

22. Sa loob ng maraming taon, pinaunlad niya ang kanyang abilidad sa pagsasalita ng iba't ibang wika.

23. Ok na sana eh. Tinawanan pa ako.

24. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

25. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

26. Pinili ng mga magulang ang pinakamalapit na paaralan sa kanilang tahanan upang hindi na mahirapan ang mga bata sa pagbiyahe patungong silid-aralan.

27. Si Juan ay nadukot ang cellphone dahil sa isang magnanakaw sa kalsada.

28. Sinubukan kong magpakilig sa aking nililigawan sa pamamagitan ng pagkanta ng isang love song.

29. Anong pagkain ang inorder mo?

30. Paglingon niya, nakakita siya sa kanyang tabihan ng isang munting palaka na parang nakatinging sa kanya

31. Isa lang ang bintana sa banyo namin.

32. Napapalibutan ako ng poot habang pinagmamasdan ko ang mga taong nagtataksil sa akin.

33. Nasa likod ng aking bahay, natatanaw ko ang bukid na puno ng sariwang mga halaman.

34. At være transkønnet kan være en udfordrende, men også en berigende oplevelse, da det kan hjælpe en person med at forstå sig selv og verden på en dybere måde.

35. Naramdaman ko ang kalungkutan na unti-unti nang napawi nang matanggap ko ang magandang balita.

36. Football players must have good ball control, as well as strong kicking and passing skills.

37. The baby is not crying at the moment.

38. Les patients sont suivis de près par les professionnels de santé pour s'assurer de leur rétablissement.

39. Påskedag fejrer Jesu opstandelse fra de døde og markerer afslutningen på Holy Week.

40. Nag-aaral ka ba sa University of London?

41. Nagsisilbi siya bilang chef upang magluto ng masarap na pagkain para sa kanyang mga kustomer.

42. After months of hard work, getting a promotion left me feeling euphoric.

43. They go to the gym every evening.

44. Mula noon ay laging magkasama ang dalawa.

45. Det er også vigtigt at varme op før træning og afkøle efter træning for at reducere risikoen for skader.

46. Tantangan hidup dapat menjadi kesempatan untuk memperluas batasan diri dan mencapai potensi yang lebih besar.

47. Ate Annika naman eh, gusto ko ng toy!

48. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

49. Ngunit lingid kay Roque, may namumuong lihim na pagkagusto sina Magda at Damaso sa isa't isa.

50. Estudyante sina Rita at Fe sa UP.

Recent Searches

technologymagkikitaoktubreenfermedades,nagpapasasapagkalungkotnapaplastikanmagtatagalsalu-salopalipat-lipatkakuwentuhannamumulotmiraminu-minutoinakalangpalabuy-laboypaglalaitnalalabicultivanahawakanadversepambatangkinapanayambibisitaagam-agamnagulathinagud-hagodmakikiraannakatayonamulatclienteshitabumibitiwculturenakatagokuwadernonahihiyanguusapanminamahalmakapalagpinag-aaralannagpalutonakakatandauulaminkinantanaglulutoskyldes,sinaliksikpagtatanimpawiinpacienciaexhaustionnai-dialumigtadnagbabalaibinaonmabatongkommunikerernakahainkahonghurtigerekampanapaulit-ulitnaiiritangdiyanpagbebentapakukuluanhinahanapkapitbahaybuwenasnearjeepneytamarawtienengarbansosorkidyaskainitanmagselosamuyinpagbibirobinentahantakotgawingbagamatpadalasuwakkagabisubject,pigilanparusahangubatritwalbayangcompletamentesementoawitinkakayananmagpa-ospitalmatangkadmalasutlanagsimulalunashelenaguidancenaalisnapapikitipagmalaakiasiatilarepublicantiboksayakaraniwangsalatfulfillingbinanggakapainkaugnayanahaskulotalastamislaruantanodtikethinigititutolfauxhomestsakaoutlinepogiifugaocontestharingpropensoelitehidingrosasnobhehe1929lapitanipinabalikreducednatingalaitakspeechesibaliksumindiwidespreadcommissionsagotmanagervanactoranotherspreadmaratingfacultycasesmalakingrecentteleviewingnag-aasikasotahananbehinddebatespowersduladenresultdidingharmfulfuncionesposterlutuingeneratedmakapilingiginitgitrefcontrolaoftenkasingnagliliyabkastilangpag-iyakinferioreskabuntisanfacilitatingestarbarongnamingmagsusuotbungaafterjunemagisipmagkakaanakinternet