Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

31 sentences found for "technology"

1. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

2. Amazon is an American multinational technology company.

3. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

4. Confocal microscopes use laser technology to create 3D images of small structures.

5. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

6. Despite the many advancements in television technology, there are also concerns about the effects of television on society

7. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

8. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

9. From its early days as a technology for the elite, to its current status as a staple in most

10. However, there are also concerns about the impact of technology on society

11. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

12. In recent years, television technology has continued to evolve and improve

13. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

14. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

15. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

16. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

17. Technology has also had a significant impact on the way we work

18. Technology has also played a vital role in the field of education

19. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

20. Television is one of the many wonders of modern science and technology.

21. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

22. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

23. The company used the acquired assets to upgrade its technology.

24. The field of entertainment has also been greatly impacted by technology

25. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

26. The nature of work has evolved over time, with advances in technology and changes in the economy.

27. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

28. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

29. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

30. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

31. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

Random Sentences

1. Amazon's customer service is known for being responsive and helpful.

2. Helte kan være en kilde til håb og optimisme i en verden, der kan være svær.

3. Kapag sumabog ang mga salot ng droga, hindi lamang ang tao ang nasasaktan, pati na rin ang buong pamilya.

4. Ano ang mga apelyido ng mga lola mo?

5. Matagal din bago napawi ang paninigas ng kanyang pigi.

6. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

7. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

8. They have planted a vegetable garden.

9. Selamat ulang tahun! - Happy birthday!

10. Kings may wield absolute or constitutional power depending on their country's system of government.

11. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

12. Wasak ang kanyang kamiseta at duguan ang kanyang likod.

13. Yep, basta lang ibibigay mo sakin ang araw mo ngayon.

14. Nagsmile si Athena tapos nag bow sa kanila.

15. Effective use of emphasis can enhance the power and impact of communication.

16. Natutuwa ako sa pag-aalaga ng mga halaman kaya nahuhumaling ako sa pagtatanim.

17. Saan naman? Sa sine o DVD na lang? tanong ko.

18. Sa sarili, nausal niyang sana'y huwag siya ang maging paksa ng paghaharutan at pagkakatuwaan ng mga agwador.

19. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

20. Banyak orang di Indonesia yang mengadopsi kucing dari jalanan atau shelter kucing.

21. Nagpaluto ako ng spaghetti kay Maria.

22. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

23. Bersatu kita teguh, bercerai kita runtuh.

24. Aquaman has superhuman strength and the ability to communicate with marine life.

25. La planificación de comidas y la preparación con anticipación pueden ayudar a mantener una alimentación saludable.

26. Kanina sabi mo joke, ngayon example. Ano ba talaga?!

27. Women's health issues, such as reproductive health and breast cancer, have received increased attention in recent years.

28. Sa isang malayong pook sa Pilipinas nakatira ang mag-asawang sina Mang Kandoy at Aling Pising.

29. Itinali ng hari ang batang higante at pinakawalan ang mga taong nakakulong sa kuweba.

30. The song went viral on TikTok, with millions of users creating their own videos to it.

31. The scientific community is working to develop sustainable energy sources to combat climate change.

32. Ibinigay ko ang aking karanasan upang matulungan ang aking mga kababayan na nangangailangan ng tulong.

33. Paano po ninyo gustong magbayad?

34. Marahil ay nai-stress ka dahil sa mga kailangang tapusin sa trabaho.

35. Isang araw, kararating pa lang ng mag-asawa mula sa pagtitinda ng gulay, galing sa kuwarto ay lumabas si Aya at hiningi ang ipinagbiling prutas.

36. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

37. Hindi ko alam ang sagot, pero sa ganang iyo, ano ang dapat gawin sa sitwasyong ito?

38. Mahilig ang mga Pinoy sa masasarap na pagkain tulad ng adobo at sinigang.

39. Naramdam ng pagkaawa si Mang Kandoy kaya't agad niyang binato ng isang piraso ng matigas na kahoy ang tigre upang malihis ang atensyon nito sa usa.

40. Some dog breeds are better suited for certain lifestyles and living environments.

41. El parto es un proceso natural y hermoso.

42. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

43. Hinawakan ko na lang yung pisngi niya. Matulog na tayo.

44. Ano ang pinapanood mo sa telebisyon?

45. Tengo tos seca. (I have a dry cough.)

46. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

47. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

48. May grupo ng aktibista sa EDSA.

49. Yung totoo? Bipolar ba itong nanay ni Maico?

50. Nang matuklasan ng binatilyong apo na siya ay isang pangit na hayop na, kumarimot siya patakas sa baranggay.

Recent Searches

technologyasthmamaubosbakenapalitangnakapilangbakakanilapunongkahoylaki-lakiawitanmakahingiiniisipsigesarongmasikmurabalingsinundogrinsnapahintoboyetputingloveletdireksyon00ammatigasmoodfilipinogayunmanlearntumubonginterestnatitiradistansyasummerresignationkalikasannapasukoreallyerrors,hugispamannakainompalayanlawadiyaryosquatterasiakonsultasyonkauntinaiiritangpinatirakumilosbagkusmankaibangvarietykomunikasyonkampeonpositibokurakotkwenta-kwentabungalavpresencemakakaespadanagpasamapanitikandiliminakalafertilizerworkshopsakopreleasedpagbatigratificante,shopeeinihandakapitbahayiiklikargahankalongawitinsilbingnakalipasikinasuklammaglutodaratingmaskiatingkapejagiyanananalongtog,tvsfitcharitablesharepulang-pulanakatitiyakpaki-chargeiparatingagilityinhalelcddumilatbalancesindividualkatawangobra-maestrapinakamatapatnilagangmagalangmabutiplasaredestalaganinyongpinamalagiumuwikombinationloripeepkuripotbubongconditioningbitawanmagaling-galingwidewidelynakabiladnangangaralbairdavailablehmmmmpasyahereniyaalbularyohotelstorybangaexperts,victoriadoonnapilingkwebangmailapmakikikainlumulusobtutusinpasaheropoorerkapamilyabiyashealthierbutikiekonomiyaemocionanteapatnapupositionerpalamutislave1929sumisidsocialepressplacehabitsharmainemiyerkulesdyipniinaaminparkingtransparentbihasapelikulasumayamagbagong-anyofuelpagkalitobienroqueparehongnegosyoreportsikatnamakalupiibinaonhopeharipangalananmarmaingpagka-maktolumiiyakpupursigiharapan