Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "new"

1. "You can't teach an old dog new tricks."

2. A new flyover was built to ease the traffic congestion in the city center.

3. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

4. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

5. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

6. Ang Chinese New Year ay isa sa pinakamahalagang pagdiriwang sa kultura ng Tsina.

7. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

8. Ang mga dragon at lion dance ay karaniwang makikita sa mga kalye tuwing Chinese New Year.

9. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

10. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

11. Ang mga paputok at pailaw ay karaniwang bahagi ng pagdiriwang ng Chinese New Year.

12. Ang mga tradisyunal na parada ay isang kakaibang aspeto ng Chinese New Year.

13. Ang pag-awit ng mga kanta at pagtugtog ng tradisyunal na musika ay bahagi ng pagdiriwang ng Chinese New Year.

14. Ang pagbibigay ng ampao ay isang tradisyonal na paraan ng pagpapakita ng paggalang sa matatanda sa Chinese New Year.

15. Ang paglilinis at pag-aayos ng bahay ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

16. Ang pagpapakain ng mga biko at tikoy ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

17. Ang pagtanggap ng mga bisita at pagkakaroon ng masayang kasiyahan ay bahagi ng mga tradisyonal na okasyon sa Chinese New Year.

18. Anong buwan ang Chinese New Year?

19. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

20. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

21. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

22. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

23. Ein frohes neues Jahr! - Happy New Year!

24. Einstein was born in Ulm, Germany in 1879 and died in Princeton, New Jersey in 1955.

25. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

26. Happy Chinese new year!

27. Has he started his new job?

28. Has she met the new manager?

29. Have you been to the new restaurant in town?

30. Have you tried the new coffee shop?

31. He has bought a new car.

32. He has learned a new language.

33. He used his credit to buy a new car but now struggles to make the monthly payments.

34. He was warned not to burn bridges with his current company before accepting a new job offer.

35. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

36. I discovered a new online game on a gaming website that I've been playing for hours.

37. I don't want to get my new shoes wet - it's really raining cats and dogs out there.

38. I don't want to spill the beans about the new product until we have a proper announcement.

39. I got a new watch as a birthday present from my parents.

40. I have started a new hobby.

41. I just launched my new website, and I'm excited to see how it performs.

42. I used my credit card to purchase the new laptop.

43. I've been using this new software, and so far so good.

44. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

45. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

46. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

47. Many dogs enjoy going on walks and exploring new environments.

48. Mathematics is an ever-evolving field with new discoveries and applications being made constantly.

49. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

50. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

51. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

52. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

53. My girlfriend looked like a beautiful lady when she walked down the stairs in her new dress.

54. Nasaan ang Ochando, New Washington?

55. Pumunta si Trina sa New York sa Abril.

56. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

57. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

58. Sa bawat Chinese New Year, ang mga tao ay nagbibigay ng mga bagong larawan at dekorasyon upang ipagdiwang ang bagong panimula.

59. Sa Chinese New Year, ang mga pamilya ay nagtitipon upang magsalu-salo at magbigayan ng mga regalo.

60. Sa Chinese New Year, ang mga tao ay nagbabasbasan at nagpapalakas ng kanilang mga panalangin para sa magandang kapalaran.

61. Sa Chinese New Year, ang mga tao ay nagbibigay ng mga pabuya upang pasayahin ang mga diyos at mga espiritu.

62. Sa Chinese New Year, ang mga tao ay naglalagay ng dekorasyon na may pulang kulay bilang simbolo ng kapalaran.

63. Sa Chinese New Year, ang mga tao ay nagpapakasaya at nagdiriwang ng malakas.

64. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

65. She has started a new job.

66. She is designing a new website.

67. She is learning a new language.

68. She is not designing a new website this week.

69. She is not learning a new language currently.

70. She learns new recipes from her grandmother.

71. Taga-Ochando, New Washington ako.

72. Television also allowed for the creation of a new form of entertainment, the television show

73. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

74. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

75. The app has also become a platform for discovering new music, with songs going viral through TikTok.

76. The charitable donation made it possible to build a new library in the village.

77. The city installed new lights to better manage pedestrian traffic at busy intersections.

78. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

79. The company is exploring new opportunities to acquire assets.

80. The company launched a series of new products, targeting different customer segments.

81. The company's acquisition of new assets was a strategic move.

82. The company's acquisition of new assets will help it expand its global presence.

83. The company's board of directors approved the acquisition of new assets.

84. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

85. The new factory was built with the acquired assets.

86. The new restaurant in town is absolutely worth trying.

87. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

88. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

89. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

90. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

91. The stock market gained momentum after the announcement of the new product.

92. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

93. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

94. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

95. The uncertainty surrounding the new policy has caused confusion among the employees.

96. They have bought a new house.

97. TikTok has inspired a new wave of viral challenges, from dance routines to lip-syncing.

98. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

99. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

100. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

Random Sentences

1. Niluto nina Tony ang isda sa kusina.

2. El que busca, encuentra.

3. Madilim ang paligid kaya kinailangan niyang salatin ang daan pabalik.

4. Pagkaraan ng ilang araw ay magaling-galing na si Aling Rosa.

5. Nagbabaga ang araw sa gitna ng tanghali, dahilan upang mabilis na matuyo ang mga damit.

6. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

7. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

8. Dinig ng langit ang hiling ni Waldo upang ang paghihirap nila ay mabigyan ng wakas.

9. Los colores cálidos, como el rojo y el amarillo, transmiten energía en una pintura.

10. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

11. Proper maintenance, such as regularly oiling the pivot point and cleaning off debris, can prolong the lifespan of scissors.

12. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

13. Pinadala na nya ang kanyang resignation letter sa pamamagitan ng email.

14. Ang sugal ay isang laro ng pagkakataon na kadalasang nagbubunga ng pagkatalo kaysa panalo.

15. Marami ang nahuhumaling sa larong mobile legends.

16. Nahuli ang salarin habang nagtatago sa isang abandonadong bahay.

17. Ano ang nasa tapat ng ospital?

18. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

19. Libre ba si Carol sa Martes ng gabi?

20. Twinkle, twinkle, little star,

21. Hallo! - Hello!

22. Kailangan mong supilin ang iyong galit upang makapag-isip nang maayos.

23. Kaninong payong ang asul na payong?

24. Nakuha ko ang first place sa aking competition kaya masayang-masaya ako ngayon.

25. Bumisita ako sa lola ko noong Mayo.

26. The movie was rated R, and therefore she wasn't allowed to watch it.

27. Taksi ang sasakyan ko papuntang airport.

28. La tos puede ser un síntoma de cáncer de pulmón.

29. Ang "sa ganang iyo" ay ginagamit upang ipakita ang pansariling pananaw o opinyon ng isang tao sa isang partikular na isyu o sitwasyon.

30. Sa ganang iyo, bakit hindi lahat ng tao ay pantay-pantay ang oportunidad sa buhay?

31. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

32. Ang rebolusyon ang tumapos sa pananakop ng mga kastila.

33. Pinag-aaralan ng mga mag-aaral ang talambuhay ni Ramon Magsaysay bilang isang "Man of the Masses."

34. Pasensya na, hindi kita maalala.

35. Masyadong mahal ang pagkain sa hotel.

36. Eh ayoko nga eh, sundae lang talaga gusto ko.

37. Si Mary ay masipag mag-aral.

38. Dos siyentos, tapat na ho iyon.

39. Nagsisimula akong mag-exercise sa hatinggabi para sa aking kalusugan.

40. Ano ang gustong orderin ni Maria?

41. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

42. Panahon ng pananakop ng mga Kastila

43. Dahil matamis ang dilaw na mangga.

44. Esta salsa es muy picante, ten cuidado.

45. Kailangan nating magplano upang mas mapadali ang pag-abot ng ating mga pangarap.

46. Los padres experimentan una mezcla de emociones durante el nacimiento de su hijo.

47. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

48. The use of emphasis is influenced by cultural and social norms.

49. Kumain sa canteen ang mga estudyante.

50. La música puede ser una carrera lucrativa para algunos músicos.

Similar Words

newsnewspapers

Recent Searches

newparipagkakataonmagpapapagodpambatangbanlagsapagkatgraphicuugud-ugodlumakadmesasulatnapakaramingkumikilosadverseintsik-behohalamagagamitmagaling-galingpatunayanhjemstedmakapagmanehopumayagsiniyasatltoeducationalbabaeinatupaghayopnaiinitankakaibalumakingcoatginisingopisinatinangkangpopcornpulahumaniniibigprinttumayolockdownnagmadalingkeepingbabaliktumabakumilosadvancementdullinfluentialculturasproductsrequiresnaguguluhangmantikamaglabatinaposkumbentosukatinstatebinasakabangisanpangungusapbabaengprimeraslugawhampaslupawordnabahalaentryspecializedpaskongnginingisihanbringsumuwaysocialestaingafonodahilngunitmaraminakatiranganak-mahirapoperatelobbynapilingpinanawankahalagadaraansynligemaglarophilosopherrestawansundaeatentopositiboumibigbilibidpinagtabuyanimagingdalaalwaysbilihinusedinisipjuicesingsingpagtayoexperts,sumunodcamerakahirapanbroadcastlabasmag-usapsafebloggers,commander-in-chiefaccederzoowinsnapapalibutandibarelevantjustkeeptungkolbowlkiniligikinagagalakmaisusuotdumarayobulalasmaliitmakapagsalitahubadhiyakayasharingmakilingguidanceuugod-ugodchartsdrivernapapansinmakasarilingfacemaskmulti-billiongenerabagenerationerpeppyquarantinelupangnamangtambayanngayosersakitkurakotpublicationnagwalismakitapracticesaddingstringinteligenteskumarimotmonitorpusongpang-aasarmailaphiligbutilnaglalaroturonharapinnagbigayanputingnagitlalapispagtitindapulubiitimpinigilanmeetingayawtusongkaninoyelotuklashiramin,dolyarchoimahiwagaisa-isasignificanttsismosatataykalikasan