Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "new"

1. "You can't teach an old dog new tricks."

2. A new flyover was built to ease the traffic congestion in the city center.

3. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

4. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

5. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

6. Ang Chinese New Year ay isa sa pinakamahalagang pagdiriwang sa kultura ng Tsina.

7. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

8. Ang mga dragon at lion dance ay karaniwang makikita sa mga kalye tuwing Chinese New Year.

9. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

10. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

11. Ang mga paputok at pailaw ay karaniwang bahagi ng pagdiriwang ng Chinese New Year.

12. Ang mga tradisyunal na parada ay isang kakaibang aspeto ng Chinese New Year.

13. Ang pag-awit ng mga kanta at pagtugtog ng tradisyunal na musika ay bahagi ng pagdiriwang ng Chinese New Year.

14. Ang pagbibigay ng ampao ay isang tradisyonal na paraan ng pagpapakita ng paggalang sa matatanda sa Chinese New Year.

15. Ang paglilinis at pag-aayos ng bahay ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

16. Ang pagpapakain ng mga biko at tikoy ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

17. Ang pagtanggap ng mga bisita at pagkakaroon ng masayang kasiyahan ay bahagi ng mga tradisyonal na okasyon sa Chinese New Year.

18. Anong buwan ang Chinese New Year?

19. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

20. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

21. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

22. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

23. Ein frohes neues Jahr! - Happy New Year!

24. Einstein was born in Ulm, Germany in 1879 and died in Princeton, New Jersey in 1955.

25. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

26. Happy Chinese new year!

27. Has he started his new job?

28. Has she met the new manager?

29. Have you been to the new restaurant in town?

30. Have you tried the new coffee shop?

31. He has bought a new car.

32. He has learned a new language.

33. He used his credit to buy a new car but now struggles to make the monthly payments.

34. He was warned not to burn bridges with his current company before accepting a new job offer.

35. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

36. I discovered a new online game on a gaming website that I've been playing for hours.

37. I don't want to get my new shoes wet - it's really raining cats and dogs out there.

38. I don't want to spill the beans about the new product until we have a proper announcement.

39. I got a new watch as a birthday present from my parents.

40. I have started a new hobby.

41. I just launched my new website, and I'm excited to see how it performs.

42. I used my credit card to purchase the new laptop.

43. I've been using this new software, and so far so good.

44. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

45. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

46. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

47. Many dogs enjoy going on walks and exploring new environments.

48. Mathematics is an ever-evolving field with new discoveries and applications being made constantly.

49. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

50. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

51. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

52. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

53. My girlfriend looked like a beautiful lady when she walked down the stairs in her new dress.

54. Nasaan ang Ochando, New Washington?

55. Pumunta si Trina sa New York sa Abril.

56. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

57. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

58. Sa bawat Chinese New Year, ang mga tao ay nagbibigay ng mga bagong larawan at dekorasyon upang ipagdiwang ang bagong panimula.

59. Sa Chinese New Year, ang mga pamilya ay nagtitipon upang magsalu-salo at magbigayan ng mga regalo.

60. Sa Chinese New Year, ang mga tao ay nagbabasbasan at nagpapalakas ng kanilang mga panalangin para sa magandang kapalaran.

61. Sa Chinese New Year, ang mga tao ay nagbibigay ng mga pabuya upang pasayahin ang mga diyos at mga espiritu.

62. Sa Chinese New Year, ang mga tao ay naglalagay ng dekorasyon na may pulang kulay bilang simbolo ng kapalaran.

63. Sa Chinese New Year, ang mga tao ay nagpapakasaya at nagdiriwang ng malakas.

64. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

65. She has started a new job.

66. She is designing a new website.

67. She is learning a new language.

68. She is not designing a new website this week.

69. She is not learning a new language currently.

70. She learns new recipes from her grandmother.

71. Taga-Ochando, New Washington ako.

72. Television also allowed for the creation of a new form of entertainment, the television show

73. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

74. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

75. The app has also become a platform for discovering new music, with songs going viral through TikTok.

76. The charitable donation made it possible to build a new library in the village.

77. The city installed new lights to better manage pedestrian traffic at busy intersections.

78. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

79. The company is exploring new opportunities to acquire assets.

80. The company launched a series of new products, targeting different customer segments.

81. The company's acquisition of new assets was a strategic move.

82. The company's acquisition of new assets will help it expand its global presence.

83. The company's board of directors approved the acquisition of new assets.

84. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

85. The new factory was built with the acquired assets.

86. The new restaurant in town is absolutely worth trying.

87. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

88. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

89. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

90. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

91. The stock market gained momentum after the announcement of the new product.

92. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

93. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

94. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

95. The uncertainty surrounding the new policy has caused confusion among the employees.

96. They have bought a new house.

97. TikTok has inspired a new wave of viral challenges, from dance routines to lip-syncing.

98. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

99. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

100. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

Random Sentences

1. You have to push yourself to the limit if you want to succeed - no pain, no gain.

2. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

3. Hindi sila makaangal sa di makatarungang pagpapautang.

4. I just launched my new website, and I'm excited to see how it performs.

5. Kumaripas ng takbo ang kabayo nang bumitaw ang sakay nitong tao.

6. Ang palaisipan ay isang uri ng suliranin na nangangailangan ng matinding pag-iisip upang malutas.

7. Hindi dapat maapektuhan ng kababawan ng mga tao ang ating mga desisyon sa buhay.

8. Parang kaming nageespadahan dito gamit ang walis at dustpan.

9. TikTok has inspired a new wave of viral challenges, from dance routines to lip-syncing.

10. Ang mga bayani ay nagbibigay inspirasyon sa mga kabataan upang maging mabuting mamamayan.

11. Sa loob ng aking dibdib, nagliliyab ang poot na pilit kong iniipon.

12. Ang malalakas na hagupit ng hangin sa gitna ng bagyo ay binulabog ang mga puno at nagdulot ng pagkasira sa mga istraktura.

13. Nasawi ang drayber ng isang kotse.

14. Wenn die Inflation zu schnell ansteigt, kann dies zu einer Wirtschaftskrise führen.

15. To infinity and beyond! at binaba ko ulit yung telepono.

16. Ang korupsiyon ay laganap sa gobyerno.

17. Frustration can be a normal part of the learning process and can lead to personal growth and development.

18. The momentum of the rocket propelled it into space.

19. May I know your name for networking purposes?

20. Ang mga karapatan ng mga anak-pawis ay kailangan ipagtanggol at ipaglaban.

21. Después de una semana de trabajo, estoy deseando que llegue el fin de semana.

22. A palabras necias, oídos sordos. - Don't listen to foolish words.

23. Nasa kanan ng restawran ang sinehan.

24. Binentahan ni Mang Jose ng karne si Katie.

25. A lot of traffic on the highway delayed our trip.

26. La música puede ser utilizada como terapia para mejorar la salud mental y emocional.

27. Hindi ko alam kung paano ko malalampasan ang aking mga agam-agam tungkol sa aking trabaho.

28. Nakangisi at nanunukso na naman.

29. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

30. Ofte bliver helte hyldet efter deres død.

31. However, there are also concerns about the impact of the telephone on society

32. Hindi naman natuwa ang mga estudyante sa pagkakaroon ng reshuffling dahil kailangan nilang lumipat ng silid-aralan at mag-adjust ulit sa kanilang mga kaklase.

33. All is fair in love and war.

34. Da Vinci estuvo interesado en la anatomía y realizó numerosos estudios sobre el cuerpo humano.

35. May mga pagkakataon na naisip niyang may kailangan siyang bilhin sa grocery store, pero pagdating niya roon, bigla niyang nalimutan kung ano iyon.

36. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

37. Ang daming labahin ni Maria.

38. Waring may bumisita sa bahay kagabi dahil bukas ang pintuan sa umaga.

39. Namumuo ang pawis sa kanyang anit at sa ibabaw ng kanyang nguso.

40. Narinig ni Ana ang boses ni Noel.

41. Mayroon kaming bahay sa Tagaytay.

42. Setelah kelahiran, bayi akan dianggap sebagai anggota baru dalam keluarga dan masyarakat.

43. Sapatos ang gustong sukatin ni Elena.

44. The patient's doctor recommended a treatment plan based on the type and severity of their leukemia.

45. She has been tutoring students for years.

46. Pinabulaanang muli ito ni Paniki.

47. Bukas ay kukuha na ako ng lisensya sa pagmamaneho.

48. Kenji nandito na siya! sabi sa akin ni Grace.

49. Ibinigay ko sa kanya ang pagkakataon na magpakilala sa kanyang mga kaisa-isa.

50. Sa pagpupulong ng mga pulitiko, inilahad nila ang kanilang mga mungkahi upang maisulong ang mga batas at polisiya.

Similar Words

newsnewspapers

Recent Searches

newmuchashumanosjerrythenaalislatejackzguardanilapitanbulalasairconoverviewstagesulingannamepressngpuntaatapasanfansnapilinginformedcurrentmainstreameasysquatterbakebehalfboyginamagkabilangisinawakhinding-hindisimbahatelevisedfluidityeconomicmag-asawangundeniableibigabaevnepangetpandemyaclockkumirotdisfrutarlayuankinagagalaknagdalamataaasmatayogkikitalalakenagpasannangyarisabongmabaitilangnaggingitinuringsobratilibabatataasmabihisaniilanandrewtaga-hiroshimakamotekwartocoaching:amoiguhitmaghahatidkidkiranpananglawbumababanakikitanghelpfuldiseaseswastetungawinimbitakayang-kayangdibarobertipinangangakchambersmalalakinagmungkahipasasalamatpostcardipinatawagmalagoeksammapahamakabut-abotberegningerpagpapakilalamatandang-matandamapakalicontrolledsandalingnagsisipag-uwianflyvemaskinererlindapagkakayakapedukasyonvitamincuandopinakamagalingmayastopnyannapakasipagpamburalilipadlumilipadrhythmtotoongnakapagreklamoressourcernecommerceclassessinagotnakadapasalubongpaladisinuotmariemakabilidelehetonagtaposbrancher,magta-trabahopilingbiocombustiblesnamumutlataga-ochandotextoadopteddiferentesteknologihumahangoskabuntisanasignaturamayabongumokayilankumakain1920smarchkinakitaansamu18thpagsagotkapainnaiinitanhatinggabiblusaformatechavesigesurgerymasungitpagkabiglamarkednasasabihanpawiintuvonagpatuloytuwidrichtatawagpag-asafurbinabaannamuhaytradeobra-maestrafar-reachinglungkutnananaginiphoneymoonsumuotpinangalanangmalapalasyostrategiesmakipagtalopansamantalakanayangpinanakabuklatbarmaaringlasingsubject