Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "media"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

3. Before television, most advertising was done through print media, such as newspapers and magazines

4. Bilang paglilinaw, ang impormasyon ay nakuha mula sa opisyal na website, hindi sa social media.

5. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

6. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

7. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

8. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

9. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

10. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

11. He was known for his active and controversial presence on social media, particularly Twitter.

12. Hindi ako sang-ayon sa mga pahayag ng ilang mga personalidad sa social media.

13. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

14. I received a lot of happy birthday messages on social media, which made me feel loved.

15. Instagram is a popular social media platform that allows users to share photos and videos.

16. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

17. Laganap ang paggamit ng social media sa kabataan ngayon.

18. Musk has faced controversy over his management style and behavior on social media.

19. Nagbabaga ang usapan ng mga opisyal sa harap ng media dahil sa kontrobersiya.

20. Naglabas ng artikulo ang pahayagan ukol sa epekto ng social media sa kabataan.

21. One of the most significant impacts of television has been on the way that people consume media

22. Sa paggamit ng mga social media, huwag magpabaya sa privacy at kaligtasan ng mga personal na impormasyon.

23. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

24. The king's family and heirs are often closely watched by the public and the media.

25. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

26. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

27. The traffic on social media posts spiked after the news went viral.

28. The website's social media buttons make it easy for users to share content on their social networks.

29. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

30. TikTok is a social media platform that allows users to create and share short-form videos.

31. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

32. Twitter Moments are collections of tweets and media about specific events or stories, allowing users to catch up on important discussions.

33. We were trying to keep our engagement a secret, but someone let the cat out of the bag on social media.

34. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

35. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

Random Sentences

1. Nationalism has been used to justify imperialism and expansionism.

2. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

3. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

4. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

5. Sa wakas ay natapos din ang matagal na labanan.

6. La tecnología ha permitido la creación de nueva música y la producción de grabaciones de alta calidad.

7. Malapit ang pook na ito sa bundok ng Rabba.

8. Marahan niyang inalis sa pagkakakawit ang mga balde.

9. The professor delivered a series of lectures on the subject of neuroscience.

10. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

11. Dapat tayong mag-ingat sa sobrang pangamba dahil ito ay maaaring makaapekto sa ating kalusugan.

12. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

13. Technology has also had a significant impact on the way we work

14. Malapit lang pala bahay niyo eh. akala ko naman malayo!

15. The feeling of frustration can lead to stress and negative emotions.

16. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

17. Sadyang masarap ang lutong ng tinapay na ito.

18. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

19. Hindi ko kinuha ang inyong pitaka.

20. Anong klaseng kuwarto ang gusto niya?

21. Eating healthy is an important way to take care of your body and improve your quality of life.

22. Sa pagsasaayos ng paaralan, ang bayanihan ng mga guro at magulang ay nagdulot ng magandang resulta.

23. Ang mga pangarap ay nakakapagbigay sa atin ng determinasyon at inspirasyon upang magpatuloy.

24. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

25. Hindi ako mahilig kumain ng pulotgata dahil sa sobrang tamis nito.

26. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

27. Walang ka kwenta-kwenta ang palabas sa telebisyon.

28. Para sa kaibigan niyang si Angela

29. Ate Annika naman eh, gusto ko ng toy!

30. Emphasis can be used to create a memorable and impactful message.

31. Sa gitna ng parke, nahanap namin ang lilim ng malalaking puno na perpekto para sa aming piknik.

32. Sa kalayaan, nakakamit natin ang tunay na katarungan at pagkakapantay-pantay.

33. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

34. Kailan ipinanganak si Ligaya?

35. Ibinigay ko ang aking panahon at atensyon sa pagtitiis ngayon upang makamit ang magandang kinabukasan.

36. Isa ang edukasyon sa pinakamahalagang bagay na hindi mananakaw ninuman.

37. Limitations can be a result of geographic location or access to resources and opportunities.

38. Wala naman akong sinabing ayaw ko ah?

39. Las plantas nativas son especies que se encuentran de forma natural en un determinado lugar y son importantes para la conservación de la biodiversidad.

40. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

41. La moda de usar ropa estrafalaria está llamando la atención de los jóvenes.

42. Les enseignants peuvent organiser des sorties scolaires pour enrichir les connaissances des élèves.

43. Nakatanggap kami ng masamang balita na ang aking kaibigan ay nawala at ito ay lubos naming ikinalulungkot.

44. Ang laki ng bahay nila Michael.

45. Limitations can be addressed through education, advocacy, and policy changes.

46. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

47. Sa loob ng simbahan, natatanaw ko ang magandang retablo at mga banal na imahe.

48. Kucing di Indonesia sering diberi nama dengan arti yang unik dan lucu.

49. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

50. Nagdesisyon siyang mag-iwan ng trabaho upang magtayo ng sariling negosyo.

Similar Words

mediante

Recent Searches

mediamalamangbeginningsiilaninulitaabottrabajarnagugutomcryptocurrency:romanticismobatomodernbarnesanimoyleowestdulotcenteromgsumasakaytinanggalimportantepinangaralantoretetumahimikisinilangkemi,baliwpingganamerikabehalfpinakamasayakamisetangtryghedgitanasboybiyaknakikitainteligentesipinabalikbellsumakitwidespreadknownvotespagbahingdiapergabebahagisumasambaplatobatisubjectsandalingmaingaytaopasaherosabihingproducepakealamanilaneksportendrewdoghomeworkdragonmapagodlatercondorichputicameratripstudentmaubostilyourlivesikatlongimportantakongkamaomagnanakawofficetamaannagkasakitkantinanongtuwahasbadlibreaddsumapiteksenathroughoutsupplytag-ulantseallottedflashngumingisiprincebuhaypointhudyatkinausappinalitanpinaghihiwaerandinirawbadingmaputinaggingkinalilibinganitinuringplanelectoralpracticadobringipinarestdaratingsinongtigrefurpotaenacultivarmakipagtalokapasyahanprovidefar-reachingkategori,orasannakakaalamparisharemangungudngodnaririnigpag-aralincompletamenteblognaghinalacigarettesgodfuncionesnagreklamogumandatenmeanseffectprocesspatrickmakapanglamangipinalitinternaislaincreaseamazoncircleconstitutionsugalwhysiguradopagtitiponnapakahangabienpelikuladumaanunangstrengthmahagwaygreatshouldcharmingnagniningningtravelerdilatitserremembermasokvitaminspresentamagsubogonepartspahingatesstulisang-dagatwalanghahatolvigtigstecrazypakainguroumilingnakabanggamakasalanangbiyernes