Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "media"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

3. Before television, most advertising was done through print media, such as newspapers and magazines

4. Bilang paglilinaw, ang impormasyon ay nakuha mula sa opisyal na website, hindi sa social media.

5. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

6. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

7. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

8. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

9. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

10. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

11. He was known for his active and controversial presence on social media, particularly Twitter.

12. Hindi ako sang-ayon sa mga pahayag ng ilang mga personalidad sa social media.

13. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

14. I received a lot of happy birthday messages on social media, which made me feel loved.

15. Instagram is a popular social media platform that allows users to share photos and videos.

16. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

17. Laganap ang paggamit ng social media sa kabataan ngayon.

18. Musk has faced controversy over his management style and behavior on social media.

19. Nagbabaga ang usapan ng mga opisyal sa harap ng media dahil sa kontrobersiya.

20. Naglabas ng artikulo ang pahayagan ukol sa epekto ng social media sa kabataan.

21. One of the most significant impacts of television has been on the way that people consume media

22. Sa paggamit ng mga social media, huwag magpabaya sa privacy at kaligtasan ng mga personal na impormasyon.

23. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

24. The king's family and heirs are often closely watched by the public and the media.

25. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

26. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

27. The traffic on social media posts spiked after the news went viral.

28. The website's social media buttons make it easy for users to share content on their social networks.

29. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

30. TikTok is a social media platform that allows users to create and share short-form videos.

31. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

32. Twitter Moments are collections of tweets and media about specific events or stories, allowing users to catch up on important discussions.

33. We were trying to keep our engagement a secret, but someone let the cat out of the bag on social media.

34. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

35. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

Random Sentences

1.

2. Practice makes perfect.

3. Sa mga mahahalagang desisyon, nagkakasundo kami bilang magkabilang kabiyak.

4. Working in a supportive and positive environment can improve job satisfaction.

5. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

6. Ang droga ay hindi solusyon sa mga suliranin ng buhay, kundi dagdag pa itong suliranin.

7. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

8. Pedeng ako na lang magsubo sa sarili ko?

9. Hang in there and don't lose hope - things will turn around soon.

10. He missed his flight and then his luggage got lost. That just added insult to injury.

11. Nice meeting you po. automatic na sabi ko.

12. Oh Aya, napatawag ka? mejo bagsak ang boses ko.

13. Nagpalipad ng saranggola si Juan sa bukirin.

14. Si Aguinaldo ay kinikilala bilang isa sa mga pinakamahalagang bayani ng Pilipinas.

15. I am absolutely confident in my ability to succeed.

16. Nakakatawa? mataray na tanong ko sa kanya.

17. Pero mukha naman ho akong Pilipino.

18. The airport was busy, and therefore we had to arrive early to catch our flight.

19. Tim Duncan was a fundamental force in the NBA, leading the San Antonio Spurs to numerous championships.

20. Malaki ang kanilang rest house sa Tagaytay.

21. Aku merindukanmu, sayang. (I miss you, dear.)

22. Les personnes âgées peuvent vivre seules ou avec leur famille ou dans des maisons de retraite.

23. Ang Ibong Adarna ay nagpapakita ng mahalagang papel ng musika at pag-awit sa kwento nito.

24. Sumagot agad si Kuya isang ring pa lang.

25. Excuse me, anong tawag mo sakin? nakangiting tanong ko.

26. Pupunta ako sa opisina ko sa Makati.

27. If you did not twinkle so.

28. He's always telling tall tales, so take his stories with a grain of salt.

29. Después de hacer ejercicio, me gusta darme una ducha caliente.

30. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

31. The king's reign may be remembered for significant events or accomplishments, such as building projects, military victories, or cultural achievements.

32. Mura lang ang mga damit sa Greenhills.

33. Iba ang landas na kaniyang tinahak.

34. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

35. Hindi na maawat ang panaghoy ng matanda nang makita ang nasirang bahay.

36. Bagama't mabait ay mailap ang hayop na ito dahil sa hiya.

37. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

38. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

39. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga mapanganib na mikrobyo sa mga kalsada at iba pang mga lugar.

40. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

41. Claro, podemos discutirlo más detalladamente en la reunión.

42. It's complicated. sagot niya.

43. Dumating na ang araw ng pasukan.

44. Mahirap mahalin ang isang taong mailap at hindi nagpapakita ng tunay na damdamin.

45. It was risky to climb the mountain during a thunderstorm.

46. Ang taong walang tiyaga, walang magtatagumpay.

47. Limitations can be a source of motivation to push oneself to achieve more.

48. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

49. Salatin mo ang mga butones ng remote upang mahanap ang tamang pindutan.

50. Einstein's work led to the development of technologies such as nuclear power and GPS.

Similar Words

mediante

Recent Searches

sinampalmediabalancesnilulondiyosnag-replyyatasaankayongginamotinantokespigasallowingbukodokaytaingaomgmagbubukidmemoriamakakakainkabilisdagaprocesomunangmulighedginangpolobinigaysumabogcreatefacebookpetsamapuputiyesdevelopedfreelancerresearchpagbahingcuentanavanceredebubongdiniinalalayanproducircoatknowspangulobarongmethodsdoesrepresentedauthorarmedactivityconditioningkutishotdogmagbibigaykindledelkanginanag-usapautomatiskmississippijameskinagatmaluwangtagalogmagpahingabihasasalbahengbateryanangangalogaywanmagpakaraminami-missmalimutandetlivepaaralanclientecomputerssinkwowkananmabangobroughtmagnifymightbisigdevelopmentbumisitasayawanjudicialkawayanayusinkakayananstringprodujomaghahabipagsasalitasikotelephonecardiwasiwasutak-biyasisternatatawainantaybungadmagsasamapinamalagimagtataaspagtawaatensyongpagkatakotsasamahanpagsisisitungawiwinasiwasnagsagawaikinakagalitpagka-maktolpodcasts,pagkalungkotdistansyamakalaglag-pantyfakepaanopagpapasandapit-haponnagsunuranpamilyangkinapanayamnapakahusaypamanhikannakakasamanakaka-inkumbinsihinnagtrabahopamasahekinasisindakantemparaturamahiyatinaypacienciababasahinexhaustionnakakatabakaraniwangnasagutanvaccinescualquierlumutangmiyerkuleshinihintaystorypartsbwahahahahahakomedornakauwiumikotano-anocanteenkesolansangannakaakyatiiwasanhigantetuktoknanonoodkassingulangmbricoskalabanpagiisipmantikanasunoggarbansoskamaliancramepatawarinparagraphsnahintakutanipapainitbumababaadvancementgrammarsiguroairplaneskauntiestadosnagniningningescuelasvitaminpatakbongbumalikpinisilpabilikindergartenvaledictorian