Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "motion"

1. At kombinere forskellige former for motion kan hjælpe med at opnå en alsidig træning og forbedre sundheden på forskellige måder.

2. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

3. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

4. Det er vigtigt at tage hensyn til ens egne begrænsninger og sundhedstilstand, når man vælger en form for motion.

5. Motion er en vigtig del af en sund livsstil og kan have en række positive sundhedsmæssige fordele.

6. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

7. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

8. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

9. Motion kan udføres indendørs eller udendørs, afhængigt af ens præferencer og tilgængeligheden af ​​faciliteter.

10. Regelmæssig motion kan forbedre hjerte-kar-systemet og styrke muskler og knogler.

11. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

Random Sentences

1. Sa panahon ng krisis, mahalagang magtulungan tayong lahat, datapapwat ay may mga taong hindi nakakaintindi ng kahalagahan nito.

2. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

3. Ang pagiging multi-talented ni Rizal ay nagpakita ng kanyang kabatiran at kagalingan sa iba't ibang larangan ng pagpapakilos.

4. Ang magsasaka ay nagtatanim ng palay sa bukid.

5. Microscopes are also used in materials science and engineering to study the microstructure of materials.

6. Sa tuwing Undas, bumibisita ang mga pamilya sa sementeryo upang mag-alay ng mga dasal para sa mga yumaong kamag-anak na maaring nasa purgatoryo pa.

7. Ang pagmamalabis sa pagkain ng matataba at malasa ay maaaring magdulot ng problema sa kalusugan.

8. Hindi umabot sa deadline ang kanyang report, samakatuwid, binawasan ang kanyang grado.

9. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

10. Nasa likod ng aking bahay, natatanaw ko ang bukid na puno ng sariwang mga halaman.

11. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

12. Pantai Tanjung Aan di Lombok adalah pantai yang terkenal dengan pasir putihnya yang halus dan air laut yang tenang.

13. The Great Wall of China is an impressive wonder of engineering and history.

14. Pumunta ako sa Iloilo noong tag-araw.

15. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

16. Sa computer nya ginawa ang disensyo ng kanyang invitation.

17. Magdoorbell ka na.

18. Skærtorsdag mindes Jesu sidste nadver med sine disciple, før han blev taget til fange.

19. El deportista produjo un gran esfuerzo para ganar la competencia.

20. Para sa akin ang pantalong ito.

21. Those experiencing baby fever may seek out opportunities to be around children, such as babysitting, volunteering, or engaging with family and friends who have kids.

22. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. Nagsalita ako upang iparating ang aking pagtutol sa kanilang plano ngunit hindi nila ito pinakinggan.

25. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

26. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

27. He makes his own coffee in the morning.

28. Takot, nanginginig ang kanyang mga daliri.

29. Maya-maya, muling naupo at dumukot ng isang lapis at isang maliit na kuwaderno sa kanyang bulsa.

30. Emphasis can help clarify and reinforce the meaning of a message.

31.

32. La realidad es a menudo más compleja de lo que parece.

33. Isasama ko ang aking mga kapatid sa pamanhikan.

34. Palibhasa ay may kakayahang magpakatotoo at magpahayag ng kanyang mga saloobin nang malinaw at mahusay.

35. Maaari po bang makahingi ng sobra sa hapunan ninyo?

36. Binigyan sya ng dentista ng gamot matapos syang bunutan ng ngipin.

37. You're stronger than this, pull yourself together and fight through the tough times.

38. The weather today is absolutely perfect for a picnic.

39. Pupunta si Trina sa Baguio sa Oktubre.

40. Isinalang ni Pinang ang lugaw ngunit napabayaan dahil sa kalalaro.

41. Nakatayo ang lalaking nakapayong.

42. Las escuelas también pueden ser religiosas o seculares.

43. Si Mary ay masipag mag-aral.

44. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

45. Isinaboy niya ang tubig na nasa harap.

46. pagkaraan ng kargang iyon ay uuwi na siya.

47. May nanganganib na mawalan ng trabaho dahil sa aksidente na nangyari sa paggawa ng proyekto.

48. Uncertainty is a common experience in times of change and transition.

49. Ano ang gustong sukatin ni Andy?

50. Pigilan nyo ako. Sasapakin ko talaga 'tong isang 'to.

Recent Searches

creationmuchmotionuminomtaledividedbalde2001governmentbookstamisdasaldiaperrememberedbobotogigisingganyantawananjagiyacrushmalihisanakfulfillingklasenggardenimagescarlocarriesplagasnatulogmaislossisinalangeffektivcomunicantapatsumagotnakatingingsigakumukulohumpayandamingsumindicallerconnectingpootmaitimbaulmedievalartshidingbrindarimbeshampaslupanagmistulangfinishedposterinalokiconstrategysinabimalinissaringabenepagbahingkumilosmetodehighbulaoverviewmapapavarioustargettabicolourhelpfulrepresentativegitarauloexplainspreadremotecompletescalenamamayatpangyayariibamag-alalaisasabadiguhitnasasakupanmasipaghumayoandrewikukumparapagiisippagpapasakitmadilimsandalingkontrabagkustirahanrewardingsinakopkasuutanemnerawardnakaakyatexhaustionkinagigiliwangkarwahengthankshubadpamilihankamaobeautifulkumirotsakalingmassachusettsindustriyamakipagkaibiganmakawalamanilbihanminatamissections,pinangkailanmanmalilimutinlintateacherstonehamdahonpoliticaltsaajeromebalemeetdamitestablishmegethastagrowthisinumpaipagmalaakirepublicantondomisteryoprobinsiyamerchandisepinggankailangangbiglanglettagalmakakatakasmedya-agwasportspotaenakasalukuyanoktubrenakabaonnanlilisiknahawakanpinahalatahitsuramarketplacesnagkakasyarevolucionadonanlakibalitainilalabasmagkapatidtinangkatatawaganpamilyanaapektuhantubigsinaliksiktanggalinnangangalitnahintakutanculturekilalang-kilalasementopayatmendiolakumarimotknowledgelalabhanumiyakkinalalagyantumawanaiilangkinalilibinganmagkasamaunitedknowssingerpahirapanyelo