Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "deal"

1. Eh what's the big deal ba? Parang kasama lang kahapon eh.

2. I don't like to make a big deal about my birthday.

3. Let's not make this into a big deal - it's just a storm in a teacup.

4. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

5. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

Random Sentences

1. Paki-drawing mo naman ako ng isang magandang larawan.

2. Ilan ang telepono sa bahay ninyo?

3. Limitations can be self-imposed or imposed by others.

4. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

5. Nakakamiss kumain ng pulotgata tuwing tag-araw kasama ng pamilya.

6. Kapag nawawala ang susi, sinasalat niya ang bawat bulsa.

7. Más vale tarde que nunca.

8. Les examens et les tests sont des évaluations importantes pour les étudiants.

9. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

10. Kebahagiaan tidak selalu tergantung pada materi atau kekayaan, tetapi pada keadaan batin dan kepuasan diri.

11. There were a lot of options on the menu, making it hard to decide what to order.

12. Pumunta sila sa albularyo upang magpagamot ng kanyang pananakit ng likod.

13. Ang sugal ay isang mapanlinlang na paraan ng pag-asang maaaring magdulot ng pagkabigo at pagkasira sa buhay.

14. Styrketræning kan hjælpe med at opbygge muskelmasse og øge stofskiftet.

15. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

16. La realidad es que todos cometemos errores, pero debemos aprender de ellos.

17. Dedication is the driving force behind artists who spend countless hours honing their craft.

18. Ang tunay na kaibigan, sa hirap at ginhawa ay kasama.

19. Tila hindi siya sang-ayon sa naging desisyon ng grupo.

20. Sa gabi, natatanaw ko ang mga bituin na kumikislap sa langit.

21. Ilalagay ko 'to sa mga action figure na collections ko.

22. Isang araw, naabutan ni Nicolas si Helena sa palasyo.

23. I am absolutely determined to achieve my goals.

24. Pupunta kami sa Laguna sa makalawa.

25. La tos puede ser causada por una variedad de factores, incluyendo alergias, infecciones y enfermedades pulmonares.

26. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

27. Tumugtog si Jemi ng piyano kahapon.

28. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

29. The company’s momentum slowed down due to a decrease in sales.

30. People who give unsolicited advice are a dime a dozen.

31. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

32. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

33. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

34. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

35. Uanset ens religiøse overbevisning er påsken en tid til at fejre håbet om nyt liv og genfødsel.

36. Danmark eksporterer også mange forskellige typer af maskiner og udstyr.

37. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

38. Mathematics can be used to model real-world situations and make predictions.

39. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

40. Napatingin ako sa orasan. 12 na ng madaling araw.

41. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

42. She does not skip her exercise routine.

43. Frustration can be a normal part of the learning process and can lead to personal growth and development.

44. Some fruits, such as strawberries and pineapples, are naturally sweet.

45. Binuksan ko ito at binasa yung nakalagay.

46. Dette er med til at skabe en høj grad af social tryghed for befolkningen, og det er også med til at sikre, at Danmark har en lav arbejdsløshed

47. Naglalaba ako ng mga sapatos pagkatapos ng malakas na pag-ulan para hindi ito maaksididente.

48. Hindi mo gusto ang lasa ng gulay? Kung gayon, subukan mong lutuin ito sa ibang paraan.

49. Nang natapos ang araw ng pagsusulit, gumawa ng paraan ang binata para makabawi sa dalaga.

50. Masakit ba?? Tumingin siya sa akin, Masakit na naman ba??!!

Recent Searches

dealbiyerneshinugotfavoripantaloprevolutionizedassociationmahahabashinesiniintayvetonamamayattiyakbalatgastokyotasainvitationnagdaosnapilitangsuriinsumusunojackzabalacongressexcusepanaynookasamacelularesbinulongskypeutilizainuliterrors,patrickevolvedmasayang-masayalockdownsumapitmakilinginumindelesumalifencingfaceitloghalagaoffentligfatalcertainwithoutberkeleyeditmultofeedbackkamponakabaonmasaktancorporationkailantandaganabihiramateryalesochandoskyldes,daangmunangnapapinanoodpagpanhiknakaratingpagtingintumunognakauponagcurvetiniodepartmentnagsinepropensohabitsmusicbefolkningenbantulotkakayanangklasengadvertisinglipadmalikotauditcebusourcesmaluwangsonidometodeprogramanabiglaeksamnakabawihinamakikinagagalakpanonoodselarestnawawalablusapongpopularpagtangisnapaluhapapagalitanbanganamulatbangladeshkumitanagtagisannangampanyangingisi-ngisingnanghihinamadnakakadalawpalipat-lipathirapcalciumpasokhumiwalaynawalangmatapobrengjobsnagpabayadkatawangpamanhikannakalilipasmamanhikanmahigitpisarahinanakitmapag-asangpagkatakotsagasaanhahatoldeliciosamagsi-skiingsasamahangirlinasikasomanghikayatinabutantotoongpaglalabangumiwinakakainnapakahabaambisyosangnovellesmahiwaganaglarointindihinkondisyonvideossinusuklalyankinumutanmagpahabaprimeroskulungansasabihinbaranggaytumamaika-12tuktoknaglokohansinisirapamagatkatutubotatanggapinpagkagisingpapalapitnasunogorkidyasculturesmismokasamaanghagdanantig-bebeintemaranasannakapikitkauntinakaingiraymasungitsunud-sunodiwananmakisuyoaregladotanawkinalimutancurtainslittletransporthinukay