Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "card"

1. Ano ang isinulat ninyo sa card?

2. Gusto mo talagang maputulan ng card? pagbabanta ni Maico.

3. He applied for a credit card to build his credit history.

4. Hindi dapat gamitin ang credit card nang walang sapat na pag-iingat dahil ito ay nagdudulot ng dagdag na gastos at utang.

5. I forgot your birthday, but here's a card anyway. Better late than never, right?

6. I reached my credit limit on the card and couldn't make any more purchases.

7. I sent my friend a bouquet of flowers and a card that said "happy birthday."

8. I used my credit card to purchase the new laptop.

9. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

10. It's wise to compare different credit card options before choosing one.

11. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

12. My daughter made me a homemade card that said "happy birthday, Mom!"

13. My sister gave me a thoughtful birthday card.

14. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

15. Paki-charge sa credit card ko.

16. She's trying to consolidate her credit card debt into a single loan with lower interest rates.

17. The credit card statement showed unauthorized charges, so I reported it to the bank.

18. They offer rewards and cashback programs for using their credit card.

Random Sentences

1. Bumuga na lang ng hangin si Maico saka tumingin kay Mica.

2. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

3. Napaiyak si Aling Pising ng makita ang mga tuyong kahoy at posporo sa ilalim ng kanilang bahay.

4. Hanggang gumulong ang luha.

5. ¿Te gusta la comida picante o prefieres algo más suave?

6. Nagliliyab ang kandila sa altar habang nagsasagawa ng dasal.

7. Ang sugal ay isang mapanlinlang na paraan ng pag-asang maaaring magdulot ng pagkabigo at pagkasira sa buhay.

8. The love that a mother has for her child is immeasurable.

9. Gusto kong bumili ng bestida.

10. Si Mabini ay naging pangalawang pangulo ng unang Republika ng Pilipinas.

11. Les médecins et les infirmières sont les professionnels de santé qui s'occupent des patients à l'hôpital.

12. Nagdala si Butch ng laruan para sa bata.

13. Gumawa ng pangit na drowing ang kaibigan ko.

14. Ang maliit na mesa ang nasa kuwarto.

15. Pakibigyan mo ng tip ang waiter.

16. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

17. Tumango tapos nag punta na kami sa may garden ng hospital.

18. Ano?! Diet?! Pero tatlong plato na yan ah.

19. Scissors can be stored in a scissor case or stand to keep them organized and easily accessible.

20. Kapag bukas palad ka sa mga taong hindi mo pa nakikilala, mas maraming taong pwedeng maging kaibigan mo.

21. Omelettes are a popular choice for those following a low-carb or high-protein diet.

22. Magpupunta kami ng hospital mamaya upang magpa-checkup.

23. The flowers are not blooming yet.

24. My husband surprised me with a trip for my birthday, and I couldn't be happier.

25. Ibinigay niya ang kanyang pera para matugunan ang mga pangangailangan ng komunidad.

26. Nasa loob ng bag ang susi ko.

27. Hun er min store forelskelse. (She's my big crush.)

28. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

29. Si Datu Duri ay matandang-matanda na.

30. Mahalagang magbigay ng respeto sa bawat isa, samakatuwid.

31. Sa aling bahagi ng pelikula ka natawa?

32. Hindi dapat basta-basta magpautang ng pera dahil ito ay maaaring magdulot ng problema sa kahuli-hulihan.

33. Muntikan na syang mapahamak.

34. Maruming babae ang kanyang ina.

35. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

36. Sa paligid ng balde, nakikia niya ang kanyang anino.

37. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

38. Agad agad din syang tumalikod at tumakbo...

39. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

40. La conciencia es la voz interior que nos guía hacia lo correcto y lo incorrecto.

41. Limitations can be cultural or societal, such as gender roles or stereotypes.

42. Matuto kang magtipid.

43. Money can be saved and invested to achieve financial goals and build wealth.

44. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

45. Good afternoon po. bati ko sa Mommy ni Maico.

46. Børn bør have adgang til sunde og næringsrige fødevarer for at sikre deres sundhed.

47. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

48. Maraming mga tao ang nakatambay pa rin sa mga tindahan sa hatinggabi.

49. Magsusuot si Lily ng baro't saya.

50. Mayroong konsyerto sa plasa mamayang gabi.

Similar Words

cardiganpostcard

Recent Searches

cardmayobroughtpakainmedievalipanlinisfeedback,asimdawterminofueljudicialsubalitbilugang1973marsotheysinabidurilarrysumugodsusunduinresearch:payboyetwordsipagamotpicsguardapingganfridaybobotosingerdaddylorenatwinklebornstrengthnagtatampoclassroomfloorbilerjamestvsmuchossteveespadaboxtiyaintroducesorrybehindevenboycheckscandidatehatingchefhoweveroverviewginagawacaracterizapamanhikannapilingprogressputingvisualsalapiwhetherlutuininformedmediumeditstyrercontrolledshouldlargecreatingseparationlearntakotbakasyonpangkatkinakabahanlandlinenahigabumababaplatformnatitiranakakatawaydelsermaghintayclasesstruggledadditionvedgreencoattanganputiaddressrecentideaconocidosnakatuwaangisasabadnalugmokchartsbighanisurroundingsadaptabilitysurveysabutanlandaskatapaterhvervslivetngisihappenednahihiloskypekindspanomrsipinansasahognakasuotnahintakutandiretsahangfar-reachingkamakailanhydelnaabutannanlakilordnewpagtataasnagmistulangnanditokapangyarihangvirksomhederatinpagkakalutomakikiraannasagutansalamangkerohistorymagbayadmagnakawpagsahodmauuponakahigangpublicitypoongumuwisagutingumisingmensngunitpesopangitgawinmusicalmabagalisinalaysaynabigkasiniuwinagpasamadisensyotinulak-tulakbumuhosewannakatulongawitanmatatalinoamendmentschoilakadpunsotowardstumambadkaratulangutilizannochekaragatanmisteryotomarnamasyallandslidelasonbugtongdesarrollarforståaminsparknaiinitanboklatesttseitutolpabalangconsist