Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "card"

1. Ano ang isinulat ninyo sa card?

2. Gusto mo talagang maputulan ng card? pagbabanta ni Maico.

3. He applied for a credit card to build his credit history.

4. Hindi dapat gamitin ang credit card nang walang sapat na pag-iingat dahil ito ay nagdudulot ng dagdag na gastos at utang.

5. I forgot your birthday, but here's a card anyway. Better late than never, right?

6. I reached my credit limit on the card and couldn't make any more purchases.

7. I sent my friend a bouquet of flowers and a card that said "happy birthday."

8. I used my credit card to purchase the new laptop.

9. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

10. It's wise to compare different credit card options before choosing one.

11. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

12. My daughter made me a homemade card that said "happy birthday, Mom!"

13. My sister gave me a thoughtful birthday card.

14. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

15. Paki-charge sa credit card ko.

16. She's trying to consolidate her credit card debt into a single loan with lower interest rates.

17. The credit card statement showed unauthorized charges, so I reported it to the bank.

18. They offer rewards and cashback programs for using their credit card.

Random Sentences

1. Nagsisindi ng ilaw ang mga bahay tuwing takipsilim.

2. A dedicated student is willing to put in the extra hours of studying to excel academically.

3. I accidentally let the cat out of the bag about my friend's crush on someone in our group.

4. Ang awitin ng makata ay puno ng hinagpis na naglalarawan ng kanyang pagkabigo sa pag-ibig.

5. Ang maaamong hayop ay nagiging mailap dahil sa pananakit ni Kiko.

6. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

7. Walang ilog ang hindi puno ng isda.

8. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

9. Scientific evidence has revealed the harmful effects of smoking on health.

10. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

11. I am absolutely excited about the future possibilities.

12. Pagod na ako, ayaw ko nang maglakad.

13. Les enseignants doivent respecter les normes de sécurité en vigueur dans les écoles pour protéger les élèves.

14. The news might be biased, so take it with a grain of salt and do your own research.

15. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

16. Bumili ako ng lapis sa tindahan

17. Gusto ni Itay ang maaliwalas na umaga habang umiinom ng kape.

18. Ang pagkamatay ni Rizal ay naging simbolo ng paglaban sa kolonyalismo at pampulitikang opresyon sa Pilipinas.

19. Kailangan nating magsumikap datapapwat marami tayong mga hamon sa buhay.

20. Las suturas se utilizan para cerrar heridas grandes o profundas.

21. Masasaya ang mga tao.

22. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

23. El cordón umbilical, que conecta al bebé con la placenta, será cortado después del nacimiento.

24. Nagpapakain ako ng aking aso sa hatinggabi bago kami pareho matulog.

25. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

26. Ibinigay ko ang aking panahon at atensyon sa pagtitiis ngayon upang makamit ang magandang kinabukasan.

27. Kaninong payong ang dilaw na payong?

28. Mi temperatura es alta. (My temperature is high.)

29. Trump's immigration policies, such as the travel ban on several predominantly Muslim countries, sparked significant debate and legal challenges.

30. Bumalik siya sa bahay nang tulala matapos mawalan ng trabaho.

31. Humahanga at lihim namang umiibig ang maraming kabinataan sa tatlong dalaga.

32. Kung anu ano ang kanilang pinag-usapan hanggang sa bigla na lang napabalikwas ang prinsipe na tila ba may tumawag sa kanya.

33. Los Angeles has a vast and efficient public transportation system, including buses, trains, and a subway network.

34. Bakit ka natawa? Bakit ka nakangiti?

35. Don't give up - just hang in there a little longer.

36. Nagbabaga ang damdamin ng bayan matapos ang mainit na balita tungkol sa katiwalian.

37. They have organized a charity event.

38. Sino ang mga pumunta sa party mo?

39. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

40. Sa gitna ng laban, nagbabaga ang determinasyon ng boksingero na manalo.

41. Ano ang pangalan ng hotel ni Mr. Cruz?

42. Ano ang kulay ng notebook mo?

43. Nag-pout si Mica saka kumapit sa braso ko.

44. Twinkle, twinkle, little star.

45. Nagpalipad ng saranggola si Juan sa bukirin.

46. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

47. At have håb om en bedre fremtid kan give os troen på, at tingene vil blive bedre.

48. Bata pa lang si Tony nang iwan sya ng kanyang ama

49. Me encanta pasar tiempo con mis amigos jugando al fútbol.

50. Yumao na ang lolo ko dahil sa katandaan.

Similar Words

cardiganpostcard

Recent Searches

cardelepantemanatiliprogrammingformatbehaviorflashcharitablecomunicarseclassmatereallyandyviewestablishedpantalonsamantalangnaglahoflamencokayabilhansteernaglalababagyobillnanayavanceredenamefuncionarpaglalabamundoinordernanakawankuwentodatimarkisinilangnanlilimosnagsuotbinangganegativemessagethanksgivingbreakdaratingstocountrypakealamsuccessfulmaskmangingisdahitikpancitroboticswifipierfindtrainingmahabolkakilalakumanankangitanbangkangnakilalapumulottaxiresortkontranagpasangatolnamilipitfavorvaledictorianpagbatialanganlumagongunitfacultyhulingfacehimdebatesgotleftcleartalesalepagkamanghaobra-maestrarenombremang-aawitnananaginiptinaasanpagpapakilalakriskanakaliliyongsumapitsimuleringermakikitulogkatuwaankabuntisannagpepekepagkagustoisasabadpagmamanehonaglalatangpagkalungkotnagkitanakakatulongvirksomheder,makatarunganggulatmagagandangbinibiyayaandadalawinkalayaanpagkuwanangapatdanpagtatakasenadordesisyonanmanilbihannapatigilhulupanghabambuhayyumabongumuponobodypanginoonkailanmanpantalongininompaalamrenaiaanungagilalagaslasrequierentransportisubowarimagdaanexperts,angelakasuutankakayananpatongprobinsyasirareachingpinag-aralanjacky---ahassapotganitopromoteantokmasipagpinatiradumilimupuanreviewersltoshinesparkemangenagisingkamustateachernenaaminnakasahodbantulotbigotesaidnagbasalikeshuwebessinumangpresyohomesmalayangnitonaghilamosbatodaysvideoalambecomegearlumangoybasahanfurydawarealayuninrestaidconcernssurgeryani