Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "magsasalita"

1. Magsasalita na sana ako ng sumingit si Maico.

2. Magsasalita pa sana siya nang biglang may dumating.

Random Sentences

1. Nag-aral ako sa library kaninang hapon.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

3. Tumahol ang aso at natakot ang pusa.

4. He does not watch television.

5. Nalungkot ang Buto nang dumilim na ang paligid.

6. Mi vecino tiene una labradora dorada que siempre corre a saludarme.

7. The concert raised funds for charitable causes, including education and healthcare.

8. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

9. Las escuelas son lugares de aprendizaje para estudiantes de todas las edades.

10. Sweetness can be used to mask other flavors and create a more palatable taste.

11. Binabati ko ang aking kaibigan sa kanyang bukas palad na pagtulong sa akin sa aking panahon ng pangangailangan.

12. Pwede ba akong pumunta sa banyo?

13. La serpiente de coral es conocida por sus llamativos colores y patrones, pero también es altamente venenosa.

14. Napatingin yung 7 na babaeng classmate namin na naguusap.

15. Nakahug lang siya sa akin, I can feel him..

16. She does not use her phone while driving.

17. Nakatayo ang aking guro sa harapan ng silid-aralan upang ipakita ang kanyang mga visual aids.

18. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

19. Yep, basta lang ibibigay mo sakin ang araw mo ngayon.

20.

21. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

22. Mathematics is an essential subject for understanding and solving problems in many fields.

23. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

24.

25. Ang biglang pagkakaroon ng mga protesta ay binulabog ang kapayapaan ng lungsod.

26. Sa loob ng isang saglit, hindi niya maulit na salatin ang biyak na pisngi.

27. Sa kanyang lumang bahay, makikita mo ang kanyang koleksyon ng mga antique na kagamitan na hitik sa kasaysayan.

28. Hindi niya inaasahan ang biglaang pagbisita ng kanyang kaibigan.

29. The love that a mother has for her child is immeasurable.

30. Ano?! Diet?! Pero tatlong plato na yan ah.

31. Mahalagang regular na magpatingin sa dentista upang maiwasan ang mga dental problem.

32. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

33. They may draft and introduce bills or resolutions to address specific concerns or promote change.

34. Hindi rin dapat supilin ang kalayaan ng mga mamamayan na magpahayag ng kanilang opinyon.

35. Gusto kong namnamin ang katahimikan ng bundok.

36. La vista desde la cima de la montaña es simplemente sublime.

37. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

38. Araw-araw na bumalik ang prinsesa sa kagubatan hanggang ang bulaklak ay napalitang ng bunga.

39. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

40. Iniintay ka ata nila.

41. La técnica de sfumato, que Da Vinci desarrolló, se caracteriza por la suavidad en la transición de los colores.

42. Amazon started as an online bookstore, but it has since expanded into other areas.

43. The stock market can be used as a tool for generating wealth and creating long-term financial security.

44. Sa gitna ng mga problema, hindi ko mapigilang maglabas ng malalim na himutok.

45. Biglang nagulat ang bata nang lumitaw sa harp niya ang isang duwende.

46. Football players wear special equipment such as shin guards to protect themselves from injury.

47. Ano namang naiisip mo? tanong ko sa mapag-asang tono.

48. Les hôpitaux sont équipés pour fournir des soins d'urgence aux patients.

49. Kaninang bandang alas-diyes ng umaga.

50. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

Recent Searches

magsasalitapanalanginmawawalakayabangannalakinagsuottangekshayaanuugud-ugodnagliwanagdiretsahangpaki-drawingnauliniganpinasalamatannakauwitig-bebentehitapagdukwangtumatakbonakakaanimbumaligtadmarketing:alagangcosechar,pagtatakapaghuhugasnalamantindakuryentecompanytumawapagsubokibinigaymamalasenviarklasekusinabumalikundeniableunconventionalisinaranakabaonnatatanawsandwichmatandangmaskarajeepneyiniirognatitiyakcramepigilanmagalitilagaypromotesumpainawardenglandexperience,tangan1960sgreatlymatulunginbutaspaketemarieeksportenpulgadagasmenkontingpublicationkombinationpuwedematabanglilycarlotsssamericanupuanenerotugondesarrollarhagdanpalakakahusayanlalongwalang-tiyakiatfpalaginilulongamitintransmitssinagotproductiontrenubokatipunanbeginningsoutlinenagpuntanapatinginmembersjenalipadinterestsaccederindividualterminoshowstelangcommunitymadamiitongseeandamingsufferparty11pmprincemaestromarioduonpopcornpartnerdenkingpromotingpasannilutocountrieshapunanwealthprovebipolarguestsinterestknowspetsacharmingshapingmagbabakasyonrestawangabepersonalsobraimbesjackzamongpedrorhythmzoomprocesotonleyteipagbilitenderbosssakinisugaredesmichaelrelativelyarmedinilingfacilitatingresponsiblecleardinggincandidatenothingdeviceskartonipapainitlongvisaidcomuneskilonyemethodsseparationlutuinneedstablecertainactivitybroadcastingeitherneverfirsthapdieach1982echavecornermotiononlymagka-apokasomagdamaganunan