Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "include"

1. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

2. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

3. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

4. Some of her most famous songs include "No Tears Left to Cry," "Thank U, Next," "7 Rings," and "Positions."

5. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

6. The symptoms of pneumonia include cough, fever, and shortness of breath.

7. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

8. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

9. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

10. This can include reading other books on the same topic, interviewing experts, or gathering data

Random Sentences

1. Limitations can be overcome through perseverance, determination, and resourcefulness.

2. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

3. Balak kong magluto ng kare-kare.

4. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

5. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

6. Women have the ability to bear children and have historically been associated with nurturing and caregiving roles.

7. Ang hirap maging bobo.

8. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

9. Ang ibon ay mabilis na lumipad palayo matapos itong pakawalan mula sa hawla.

10. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

11. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

12. Det er en metodisk tilgang til at forstå verden omkring os og finde årsager til de fænomener, vi observerer

13. Ang sugal ay isang mapanlinlang na industriya na nakatuon sa pagkuha ng pera mula sa mga manlalaro.

14. Ilang araw ang reservation natin sa hotel?

15. Bilang pasasalamat, si Hidilyn Diaz ay nagbigay ng inspirasyon sa pamamagitan ng motivational talks.

16. Sa gitna ng dilim, natagpuan niya ang liwanag sa pamamagitan ng pag-iisa.

17. Kasingtigas ng loob ni Sultan Barabas.

18. Uminom siya ng maraming tubig upang iwasan ang bungang-araw.

19. Sweetness can be a source of comfort and pleasure for many people.

20. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

21. Nag-alok ng tulong ang guro sa amin upang matugunan ang mga hamon ng bagong kurikulum.

22. ¿Cuándo es tu cumpleaños?

23. Las hierbas silvestres crecen de forma natural en el campo y se pueden utilizar en infusiones.

24. May konsyerto sa plasa mamayang gabi.

25. Børn med særlige behov har brug for ekstra støtte og ressourcer for at trives.

26. Nais ko sanang sabihin sa iyo na may gusto ako sa iyo nang mas maaga pa.

27. He has been working on the computer for hours.

28. The patient experienced hair loss as a side effect of chemotherapy for leukemia.

29. Maraming alituntunin ang ipinatutupad sa eskwelahan.

30. There are a lot of books on the shelf that I want to read.

31. You can find freelance writers who are willing to work for cheap rates, but good ones are not a dime a dozen.

32. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

33. Con permiso ¿Puedo pasar?

34. Dahil sa pagtaas ng populasyon sa bansa, yumabong ang pagtatayo ng mga condominiums at mga townhouses.

35. Ako si Minervie! Ang dyosa ng dagat! Dahil sa kasamaan mo, parurusahan kita! Simula ngayon, hindi ka na maglalakad sa lupa

36. They have been cleaning up the beach for a day.

37. Itinuturo siya ng mga iyon.

38. The objective of football is to score goals by kicking the ball into the opposing team's net.

39. Nagtataka ako kung bakit hindi mo pa rin maipaliwanag sa akin kung ano ang totoong dahilan.

40. Walang matigas na tinapay sa gutom na tao.

41. Ang matanda ay malilimutin na kaya’t kailangan niya ng alalay sa pag-alala ng mga bagay.

42. Ang sakit ng kalingkingan ay ramdam ng buong katawan.

43. Dahil sa magandang boses at musika, nahuhumaling ako sa panonood ng mga musical plays.

44. Spillene kan også være afhængige af held, dygtighed eller en kombination af begge dele.

45. Sí, claro, puedo esperar unos minutos más.

46. I am enjoying the beautiful weather.

47. Les employeurs peuvent utiliser des méthodes de travail flexibles pour aider les travailleurs à équilibrer leur vie professionnelle et personnelle.

48. Ang mga mamamahayag ay nagsusulat ng mga balita para sa pampublikong impormasyon.

49. At hanggang ngayon nga ay pinatutunayan pa rin ng mga aso na sila ay tapat sa kanilang mga amo.

50. Nagpaluto ako ng spaghetti kay Maria.

Recent Searches

includenagagandahanbringingnapapatinginpublishedaffectinventionnagpapaigibenterlumagoasthmacupidnewsisinaboynapaluhagarciabalikatradiomundonakakapamasyalkumukuhapakanta-kantangmagkakailakaaya-ayangmanlalakbaypagpapakilalapare-parehovideos,posporonagtitindanagliliyabpakikipagbabaginasikasopinakamahabaerlindanahawakannakakabangonmalayopanghabambuhaylabispilipinasnecesariogumawanakikitangpalaisipaniloilopaoslot,magsugalinakalabalahiboprimerosskyldes,orkidyashayopipinauutangkumananevolucionadonanangistumigilnaglulusakiniiroghalinglingmahahawalibertypaglingonpalasyoanumanbutassikatvegasmagtanimgasmenmaluwagmaayosmatayogotherssadyangdiseasebagamadadalosapagkatmagkasinggandasiponbilibkananlarongkirotpinagiyakmaglalakaddalawagiveharapokaynakasuotanongbasahiniconicmalambingmalumbaytignannag-replyfrescoutilizaleadingfewalagacontestfeedback,ilangrabeelvissalamassestryghedschoolsmatchingalokleyteipagbiliwalismightprovidemapuputimarsoriskrosefertilizerjerryblesscescouldauthorabsmacadamiafeelingpamimilhingkapilinggitanasexampleamounttypesestablishedpuntacausesnalalamanmahiwagakulungannanalopamagatheartkahoyatensyonumiwasbabasahinmaitimpookpagsuboktotooipinahamakestasyonhagdananculturespapalapitgagandakatagalhatinggabiminahandoktorhinabinapagtantobinibilijacemaliniscapitalistpagkamulatsponsorships,pinahalatapagkakatayopagluluksamagsasalitanakaliliyongnagtatampopinapakiramdamannakakadalawpinagtagpopaki-ulitpagkakamalimakakawawainspirasyonpagkakalutoendviderekarununganmensajeskinauupuangmamanhikanpaglinganewpupunta