Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "lot,"

1. A lot of birds were chirping in the trees, signaling the start of spring.

2. A lot of laughter and joy filled the room during the family reunion.

3. A lot of money was donated to the charity, making a significant impact.

4. A lot of noise from the construction site disturbed our peace and quiet.

5. A lot of people volunteer their time and resources to help those in need.

6. A lot of rain caused flooding in the streets.

7. A lot of snow fell overnight, making the roads slippery.

8. A lot of time and effort went into planning the party.

9. A lot of traffic on the highway delayed our trip.

10. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

11. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

12. Estoy sudando mucho. (I'm sweating a lot.)

13. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

14. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

15. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

16. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

17. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

18. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

19. I received a lot of gifts on my birthday.

20. I received a lot of happy birthday messages on social media, which made me feel loved.

21. I'm going through a lot of stress at work, but I'm just trying to hang in there.

22. Magkita tayo sa parking lot ng Luneta Park.

23. She has made a lot of progress.

24. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

25. The company lost a lot of money by cutting corners on product quality.

26. The website has a lot of useful information for people interested in learning about history.

27. There are a lot of amazing destinations to explore around the world.

28. There are a lot of benefits to exercising regularly.

29. There are a lot of books on the shelf that I want to read.

30. There are a lot of opportunities to learn and grow in life.

31. There are a lot of reasons why I love living in this city.

32. There were a lot of boxes to unpack after the move.

33. There were a lot of flowers in the garden, creating a beautiful display of colors.

34. There were a lot of options on the menu, making it hard to decide what to order.

35. There were a lot of people at the concert last night.

36. There were a lot of toys scattered around the room.

37. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

38. We have a lot of work to do before the deadline.

39. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

40. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Danmark eksporterer også mange forskellige typer af maskiner og udstyr.

2. Dahil malilimutin ako, nakalimutan ko na naman ang pangalan ng bagong kaklase.

3. Itinago ni Luz ang libro sa aparador.

4. The company had to cut costs, and therefore several employees were let go.

5. Isang linggo nang makati ho ang balat ko.

6. Piece of cake

7. Nagkaroon sila ng maraming anak.

8. Confocal microscopes use laser technology to create 3D images of small structures.

9. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

10. Nang muling lumusob ang higante, pinaulanan nila ito ng pana sa dibdib.

11. Ito na yata ang pinakamatabang babae na nakilala niya.

12. Ang pagkakahuli sa salarin ay nagdulot ng kaluwagan sa mga biktima at kanilang pamilya.

13. I am teaching English to my students.

14. Ipinakita ng albularyo ang kanyang halamang gamot na ginagamit niya sa pagpapagaling.

15. Ang mga nanonood ay para-parang nangapatdan ng dila upang makapagsalita ng pagtutol.

16. Alam kong parang biglaan, pero sana pwede ba kita makilala?

17. Nogle helte er kendte for deres modige handlinger under krig.

18. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

19. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

20. My sister gave me a thoughtful birthday card.

21. Maiiwasan ang bungang-araw kung paliligo nang regular.

22. Matagal ko na syang kaibigan sa Facebook.

23. Hoy bakit, bakit dyan ka matutulog?

24. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

25. Diretso lang, tapos kaliwa.

26. Nagtapos siya ng kolehiyo noong 1982.

27. Sino ang kasama niyang nagbakasyon?

28. Ako ay nagtatanim ng mga halaman sa aking bakuran.

29. The United States is a federal republic, meaning that power is divided between the national government and the individual states

30. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

31. Pero bigla na lang siyang hindi nagpakita.

32. Disculpe; ¿me puede ayudar por favor?

33. Si Datu Duri ay matandang-matanda na.

34. Nasa Massachusetts ang Stoneham.

35. Setelah kelahiran, calon ibu dan bayi akan mendapatkan perawatan khusus dari bidan atau dokter.

36. Ang sugal ay isang mapanlinlang na industriya na nakatuon sa pagkuha ng pera mula sa mga manlalaro.

37. Ang aking kaibuturan ay nababagabag sa mga pangyayari sa mundo ngayon.

38. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

39. Sa gitna ng mga problema, hindi ko mapigilang maglabas ng malalim na himutok.

40. ¿De dónde eres?

41. Ano ang ipinabalik mo sa waiter?

42. The Lakers continue to be a dominant force in the NBA, with a dedicated fan base and a commitment to excellence on and off the court.

43. Me da miedo pensar en lo desconocido, pero al final, "que sera, sera."

44. Nakakamangha naman ang mga tanawin sa lugar nyo Edwin.

45. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

46. May kinuha sya sa backpack nya, Dapat gumagamit ka nito.

47. Napahinto siya sa pag lalakad tapos lumingon sa akin.

48. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

49. Hinipan-hipan niya ang manipis na dibdib.

50. He was already feeling sad, and then his pet passed away. That really added insult to injury.

Recent Searches

lot,kommunikerermagpakaramiuulaminanumanproudmaisusuotlubosiniindalikodpagongkaliwatinulak-tulakdesign,kabiyakneronapilitangiyakcampaignssumayaintereststig-bebentepagkakapagsalitabinuksanpumitasangalkikofacesikatmaonghimkapataganparusahanpaidmagbantayngayogivelasakoreanagpepekeiintayintipadvancedlaganapexamplekapilingcryptocurrency:additionallyanywherenapatingalaprocesopropesordilimnagagamitknightkumaripashampaslupaadverselylockdownexpectationsvetobinulongmayamangsocialeaanhinpronoungreatnakabuklatmasaganangkomunikasyonwebsitepangkaraniwanmarumigrocerygracebayadworryhinalungkatsasamahannakakunot-noongginugunitasparepinagmamalakitinanggalhawaiiinfluencediagnosespagdiriwangpasinghalsedentarytumawabagyobagyongperseverance,ngunitcomfortexcitedmagdugtongnagdaoskayapakilagaylahatpatiencematapangpakistannagtrabahoatekuligligtumalabconsumekayexpresanbatokmakapaniwalaibaliklimosbumabapasokpakinabanganmagulayawbinibinipagpalitpaglalayagpasaheroapologeticnoonnatandaantaksianigutomnamulatautomationstringrevolutionizedlumilipadlumusobcontinuefuturepanginoonitemsmakausapcrushipaghandapinatiravehiclescultivar1970spoongkinakitaannakikiafollowingchecksnakagalawbasketballginahumanosgumuhitofrecenpinangalanangcuentanumiisodawtoritadongnapakamisteryosobutikimarahiltuwangkamag-anakmataaasindependentlybukodmayamanpinagtelebisyonagostoistasyonelectoralnapakatagalhundredschoolshoneymoonapelyidonaglakadnangingilidmagkasamatandangsabongbinilifavormatalinobalangmasaktansiguradoreorganizingrecibirnabasainferioresnahantadmalapitshinessara