Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "lot,"

1. A lot of birds were chirping in the trees, signaling the start of spring.

2. A lot of laughter and joy filled the room during the family reunion.

3. A lot of money was donated to the charity, making a significant impact.

4. A lot of noise from the construction site disturbed our peace and quiet.

5. A lot of people volunteer their time and resources to help those in need.

6. A lot of rain caused flooding in the streets.

7. A lot of snow fell overnight, making the roads slippery.

8. A lot of time and effort went into planning the party.

9. A lot of traffic on the highway delayed our trip.

10. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

11. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

12. Estoy sudando mucho. (I'm sweating a lot.)

13. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

14. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

15. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

16. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

17. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

18. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

19. I received a lot of gifts on my birthday.

20. I received a lot of happy birthday messages on social media, which made me feel loved.

21. I'm going through a lot of stress at work, but I'm just trying to hang in there.

22. Magkita tayo sa parking lot ng Luneta Park.

23. She has made a lot of progress.

24. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

25. The company lost a lot of money by cutting corners on product quality.

26. The website has a lot of useful information for people interested in learning about history.

27. There are a lot of amazing destinations to explore around the world.

28. There are a lot of benefits to exercising regularly.

29. There are a lot of books on the shelf that I want to read.

30. There are a lot of opportunities to learn and grow in life.

31. There are a lot of reasons why I love living in this city.

32. There were a lot of boxes to unpack after the move.

33. There were a lot of flowers in the garden, creating a beautiful display of colors.

34. There were a lot of options on the menu, making it hard to decide what to order.

35. There were a lot of people at the concert last night.

36. There were a lot of toys scattered around the room.

37. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

38. We have a lot of work to do before the deadline.

39. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

40. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Magsasalita pa sana siya nang biglang may dumating.

2. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

3. Gaano ko kadalas dapat inumin ang gamot?

4. The library has a variety of books to choose from, ranging from classics to modern literature.

5. La labradora de mi hermana es muy cariñosa y siempre está buscando atención.

6. Matagal ko nang pinapaliwanag sa kanila ang mga dahilan kung bakit ako tumututol sa kanilang plano.

7. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

8. Ang pangamba ay maaaring maging mabuting tagapag-ingat upang maiwasan ang posibleng peligro.

9. Sang-ayon ako sa kagustuhan mo na magpatuloy sa iyong pag-aaral.

10. Higupin ng araw ang tubig-ulan sa kalsada.

11. They analyzed web traffic patterns to improve the site's user experience.

12. Ang aking kabiyak ay ang aking pinakamatalik na kaibigan at tagapagtanggol.

13. Ibinigay niya ang kanyang panahon upang magbigay ng kaunting kasiyahan sa mga taong malungkot.

14. **You've got one text message**

15. Eksport af fødevarer fra Danmark er en vigtig del af landets økonomi.

16. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

17. Pasensiya na kayo, Ale, sabi ng bata.

18. Makikita mo sa google ang sagot.

19. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

20. Sino yung naghatid sayo? biglang tanong niya.

21. Tuwing may sakuna, nagkakaisa ang mga Pinoy sa pagtulong sa kapwa.

22. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

23. Ang pagbibigay ng alay sa mga diwata ng kalikasan ay isang mahalagang ritwal sa kanilang kultura.

24. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

25. Kahit malilimutin si Mia, sinisikap niyang ayusin ang kanyang schedule para maging maayos ang kanyang araw.

26. Hindi na sila nasisiyahan sa nagiging asal ng bata.

27. Pneumonia can be caused by bacteria, viruses, or fungi.

28. Hindi dapat natin pigilan ang ating mga pangarap, kundi pagsikapan nating tuparin ang mga ito.

29. Mon mari et moi sommes mariés depuis 10 ans.

30. La música también es una parte importante de la educación en España

31. Mahusay na mahusay kumita ng pera si Kablan.

32. Siguro matutuwa na kayo niyan.

33. Beaucoup de gens sont obsédés par l'argent.

34. Ang mahal pala ng ticket papuntang Amerika!

35. At blive kvinde handler også om at udvikle sin personlighed og identitet.

36. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

37. Sa loob ng simbahan, natatanaw ko ang magandang retablo at mga banal na imahe.

38. Araw-araw ay ganoon nga ang ginawa ng tusong si Paniki.

39. Selain agama-agama yang diakui secara resmi, ada juga praktik-praktik kepercayaan tradisional yang dijalankan oleh masyarakat adat di Indonesia.

40. Sa paligid ng bundok, naglipana ang mga ibon na nagpapaganda sa tanawin.

41. Puwede bang pahiram ng isang kutsara? Nakalimutan ko ang aking sa bahay.

42. May bagong promotion ako sa trabaho kaya masayang-masaya ako ngayon.

43. Ipapainit ko ho ito sa kusinero namin.

44. Ang kasal ay nagbibigay ng mga ala-ala at emosyon na hindi malilimutan ng mga taong kasama sa okasyon.

45. Que la pases muy bien

46. She is drawing a picture.

47. Ang pagkain ng masusustansyang pagkain at pag-aalaga sa aking katawan ay isang nakagagamot na paraan upang mapanatili ang aking kalusugan.

48. En af de mest synlige områder, hvor teknologi har gjort en stor forskel, er i elektronik

49. When life gives you lemons, make lemonade.

50. Oh gosh. Inintay pa sya ng prince, what does it mean?

Recent Searches

naiisipmagbibiladricalot,iniindaaseanexpresanrenacentistanaglokohanalas-dosginawaransementeryolumalangoytinulak-tulaknageenglishpinapakiramdamanpagkakayakapnagtatrabahopagkakatayogayunpamanmagkakagustonakatayoeksportendulanaglakadpaumanhinsaritatreatspinagkiskisnagtataasinferiorestatlumpungnagpabayadnagsunuranmakapagsabiagam-agamerhvervslivetnasasakupanbibisitamag-asawanagtatampopagka-maktolnananaginipmakikiraanpagelargobiensangsearch1787palagingbasahansaan-saanmedya-agwamabiroumagangsinoseryosongpagbibirosanggolkapitbahayregulering,butikitrabahopagtatakanagbentaitinaasculturasnakabluelikessinumangeducationalhintuturopangyayaringmagtataasdiapernakapangasawapagpapatubonapadamikinikitamagsalitapinakamahalagangpinagsikapanmagta-trabahosugatdeterminasyonheartbeatdaysmababasag-ulopaanobumalikrevisedalacigarettejackztawananinaabotmaingaynahawakankawili-wilimataraysilapaki-bukasdenkanilavegaspanataginiangatberetigustongpalayogawadyosaninyonghinahaplosmandirigmangipinambilibankpesospauwinanigasandreaanteslakadutilizanhihigitsigurometodisknangingilidbiglaankauntipayapangunconventionalnabiglamaligayamaranasanteachingsmakatitulongunostraditionallugawctricaskatibayangincrediblecommercialhelenapakibigayeconomicgrocerykaninasilangmassachusettsobservation,pangalananmaestratenidonagplayundeniablekanayangginaipinansasahogniyanmangingisdangumabotherramientasinterests,natuwatumamishaponnaaksidentegospelmamahalinmaasahanhouseholdumigtadgiyerapatakbopakinabangannakatuonnagsinemauupoisinagottuluyangnamumulahulihanopisinao-ordernai-dialsasakaymiyerkulesunidosmagdamagtinataluntonfactoresberegningermakapalmagagamitkommunikererlumutang