Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "lot,"

1. A lot of birds were chirping in the trees, signaling the start of spring.

2. A lot of laughter and joy filled the room during the family reunion.

3. A lot of money was donated to the charity, making a significant impact.

4. A lot of noise from the construction site disturbed our peace and quiet.

5. A lot of people volunteer their time and resources to help those in need.

6. A lot of rain caused flooding in the streets.

7. A lot of snow fell overnight, making the roads slippery.

8. A lot of time and effort went into planning the party.

9. A lot of traffic on the highway delayed our trip.

10. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

11. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

12. Estoy sudando mucho. (I'm sweating a lot.)

13. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

14. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

15. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

16. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

17. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

18. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

19. I received a lot of gifts on my birthday.

20. I received a lot of happy birthday messages on social media, which made me feel loved.

21. I'm going through a lot of stress at work, but I'm just trying to hang in there.

22. Magkita tayo sa parking lot ng Luneta Park.

23. She has made a lot of progress.

24. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

25. The company lost a lot of money by cutting corners on product quality.

26. The website has a lot of useful information for people interested in learning about history.

27. There are a lot of amazing destinations to explore around the world.

28. There are a lot of benefits to exercising regularly.

29. There are a lot of books on the shelf that I want to read.

30. There are a lot of opportunities to learn and grow in life.

31. There are a lot of reasons why I love living in this city.

32. There were a lot of boxes to unpack after the move.

33. There were a lot of flowers in the garden, creating a beautiful display of colors.

34. There were a lot of options on the menu, making it hard to decide what to order.

35. There were a lot of people at the concert last night.

36. There were a lot of toys scattered around the room.

37. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

38. We have a lot of work to do before the deadline.

39. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

40. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Nakatira si Nerissa sa Long Island.

2. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

3. Dalhan ninyo ng prutas si lola.

4. Gusto kong manood ng sine bukas, bagkus magbabasa ako ngayon ng libro.

5. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

6. Kebahagiaan dapat ditemukan dalam hubungan yang sehat dan penuh cinta dengan keluarga, teman, dan pasangan.

7. Marahil ay hindi mo pa nakikita ang bagong pelikulang ito kaya't dapat mo itong abangan.

8. Binentahan ni Aling Maria ng prutas si Katie.

9. Las plantas suculentas son conocidas por su capacidad para almacenar agua en sus tejidos.

10. Tanggalin mo na nga yang clip mo!

11. Pagpasok niya sa bahay, nabigla siya sa liwanag na biglang sumulpot.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Los adolescentes son especialmente vulnerables al uso de drogas debido a la presión social y la curiosidad.

14. Makapiling ka makasama ka.

15. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

16. Has he learned how to play the guitar?

17. Maraming bayani ang nakalikha ng mga bagong teknolohiya at kaisipan na naging pundasyon ng progreso ng bansa.

18. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

19. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

20. Nag-aalala ako dahil biglaan siyang umalis nang walang abiso.

21. Nakatayo ito sa kanyang tabi at hawak na naman ang kanyang kuwaderno at lapis.

22. Kukuha lang ako ng first aid kit para jan sa sugat mo.

23. Pinabulaanang muli ito ni Paniki.

24. ¿Cuánto cuesta esto?

25. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

26. Dedication is what separates those who dream from those who turn their dreams into reality.

27. Magandang araw, sana pwede ba kita makilala?

28. Emphasis can be used to create a sense of drama or suspense.

29. Es un placer conocerte, ¿Cómo te llamas?

30. Inilista ni Michael ang lahat ng maiingay sa klase.

31. Sa likod ng mga tala, kahit sulyap lang, Darna

32. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

33. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

34. Ano ang kulay ng mga prutas?

35. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

36. Les personnes âgées peuvent bénéficier d'un régime alimentaire équilibré pour maintenir leur santé.

37. Lumingon ang bata sa kanyang paligid, inisa-isa ang mga mukhang nakatunghay sa kanya

38. Kung kulang ka sa calcium, uminom ka ng gatas.

39. Los padres pueden elegir tener un parto en casa o en un hospital, dependiendo de sus preferencias y necesidades.

40. Binili ni Rita ang damit sa tindahan.

41. J'ai perdu mes clés quelque part dans la maison.

42. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

43. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

44. By the way, when I say 'minsan' it means every minute.

45. Elektronik kan være en kilde til underholdning og sjov.

46. Nagdala si Butch ng laruan para sa bata.

47. Dahil sa sobrang init, naglipana ang mga puting ulap sa kalangitan.

48. Kapag mayroong sakit sa ngipin, kailangan mong magpakonsulta agad sa dentista.

49. Ada berbagai jenis kucing yang ada di Indonesia, seperti kucing Persia, Siamese, dan Scottish Fold.

50. Ang mga puno ng kape ay nagbibigay ng mabangong amoy sa buong paligid.

Recent Searches

byggetlot,pinapakingganmagawapakibigyanhalakhaknahantadcredittagalgitanasnapaikawsectionshimayinligaliggownmayabangdaladalaknightpasasaanlayastsaapetsangdalawrememberbeforecallinghatecurrentexplainnahuhumalingisasagotkinabubuhaynearpaanongtumagalmorningkagipitanmaintindihanartistnaaksidentemagtagohumblegamotininomkinakainmalusogdietmelissabeautifulanilatanyagdatimaghintayfederalbalingansumigawhusocomunicangalitspeedrateputieskwelahanguidancetinulak-tulakmaihaharappagngitinagpepekealas-diyeslibangangumawaambisyosangsapilitangnagbentatsismosanagbibigayanparaangpakilagayadobomamarilstobasahinkagandahininginakakakuhacelularesmangingisdadalawamorenabellcalambagrocerykwebafurexamjaceiconpyestacommercepagiisipmilyongdaramdaminnakapagngangalitmedya-agwamakipag-barkadamagkamaliawtoritadongnasasalinanprodujosinundanlolakilongsongsbarcelonabumotoyoutubetanganheipublicationsalagabejackzscientistthencebuknowsngpuntaataquesbinabaindenpointvanpatrickcontrolaaddingpuntapotaenakinatatalungkuangnakabulagtangmagkikitanakakapamasyalgayunpamanpagbabagong-anyomagsasalitaenfermedades,punong-kahoykawili-wilisumakaykabinataannaglipananapapatungonagandahansalenagbiyayapulang-pulanaka-smirkmakikiraanmagkakailanakakagalingmagbibiyahemusiciannanghihinakinatatakutannagtitindamakikipag-duetopare-parehomoviesginugunitapahiramnagkasakithoneymoonnalugmokmaliwanaginaaminhimihiyawkumikilospaki-drawingnakapasokmagkaibangkabundukannagpagupitnaibibigaytungawbalitanapakamotpronouniintayiniwinasiwasliv,inakalanghinimas-himasinirapannapaiyaknakaririmarimpaglalabadakonsultasyonbinibiyayaanmatapobrengpinakamahaba