Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "lot,"

1. A lot of birds were chirping in the trees, signaling the start of spring.

2. A lot of laughter and joy filled the room during the family reunion.

3. A lot of money was donated to the charity, making a significant impact.

4. A lot of noise from the construction site disturbed our peace and quiet.

5. A lot of people volunteer their time and resources to help those in need.

6. A lot of rain caused flooding in the streets.

7. A lot of snow fell overnight, making the roads slippery.

8. A lot of time and effort went into planning the party.

9. A lot of traffic on the highway delayed our trip.

10. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

11. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

12. Estoy sudando mucho. (I'm sweating a lot.)

13. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

14. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

15. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

16. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

17. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

18. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

19. I received a lot of gifts on my birthday.

20. I received a lot of happy birthday messages on social media, which made me feel loved.

21. I'm going through a lot of stress at work, but I'm just trying to hang in there.

22. Magkita tayo sa parking lot ng Luneta Park.

23. She has made a lot of progress.

24. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

25. The company lost a lot of money by cutting corners on product quality.

26. The website has a lot of useful information for people interested in learning about history.

27. There are a lot of amazing destinations to explore around the world.

28. There are a lot of benefits to exercising regularly.

29. There are a lot of books on the shelf that I want to read.

30. There are a lot of opportunities to learn and grow in life.

31. There are a lot of reasons why I love living in this city.

32. There were a lot of boxes to unpack after the move.

33. There were a lot of flowers in the garden, creating a beautiful display of colors.

34. There were a lot of options on the menu, making it hard to decide what to order.

35. There were a lot of people at the concert last night.

36. There were a lot of toys scattered around the room.

37. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

38. We have a lot of work to do before the deadline.

39. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

40. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

2. Pinigilan nya ang mga kamay ko, Wag!

3. Pagkain ko katapat ng pera mo.

4. Bakasyon ko na sa susunod na buwan.

5. Maraming natutunan ang mga estudyante dahil sa magaling na pagtuturo ng guro.

6. Hinanap niya lahat ng kabarkada niya sa sugal at sinisi sa nangyari sa kanya.

7. Tumango ako, you want? alok ko sa kanya.

8. Sa pamamagitan ng pag-aaral ng mga relihiyon, mas naging bukas ang aking kamalayan sa iba't ibang paniniwala.

9. Las hojas de mi cuaderno están llenas de garabatos y notas.

10. Waring pamilyar sa akin ang lalaking iyon, ngunit hindi ko maalala kung saan kami nagkita.

11. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

12. A father's love and affection can have a significant impact on a child's emotional development and well-being.

13. Les visites sont souvent autorisées à l'hôpital pour soutenir les patients pendant leur convalescence.

14. Durante el invierno, las personas usan ropa más abrigada como abrigos, gorros y guantes.

15. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

16. Amazon's Kindle e-reader is a popular device for reading e-books.

17. Tinawag nilang ranay ang insekto na katagalan ay naging anay.

18. Nang marating niya ang gripo ay tungo ang ulong tinungo niya ang hulihan ng pila.

19. Maaf, saya terlambat. - Sorry, I'm late.

20. Omelettes can be seasoned with salt, pepper, and other spices according to taste.

21. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

22.

23. Ano naman ang gagawin mo sa inyong hardin? wika ng binata

24. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

25. Ano ang sasayawin ng mga bata?

26. Ang sabi nya inaantay nya daw girlfriend nya! Ang sweet!

27. Paano po ninyo gustong magbayad?

28. Ang mailap na kaligayahan ay kailangan hanapin ng mabuti.

29. Ipabibilanggo kita kapag di mo inilabas ang dinukot mo sa akin.

30. Saan niya pinapagulong ang kamias?

31. Athena. nagulat siya at bigla niyang pinatay yung monitor.

32. All these years, I have been making mistakes and learning from them.

33. Ah miss, tanong lang... Iyo bang lahat yan?

34. Wag mo ng pag-isipan, dapat pumunta ko.

35. Sa kanyang propesyonal na larangan, itinuturing siyang eksperto dahil sa kanyang natatanging abilidad.

36. You can always revise and edit later

37. Me gusta escribir cartas de amor a mi pareja en el Día de San Valentín.

38. Maraming alituntunin ang ipinatutupad sa eskwelahan.

39. Ang pagtawanan at mag-enjoy kasama ang mga kaibigan ay isang nakagagamot na aktibidad.

40. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

41. Ariana first gained fame as an actress, starring as Cat Valentine on Nickelodeon's shows Victorious and Sam & Cat.

42. The information might be outdated, so take it with a grain of salt and check for more recent sources.

43. Narinig ko ang lagaslas ng tubig mula sa shower.

44. Dahil sa kakulangan ng kalinisan, naglipana ang mga daga sa tindahan.

45. Mahusay mag drawing si John.

46. Sa sobrang pagod, nagawa niyang paglimot sa mga pangyayari ng nakaraang araw.

47. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

48. Ang tunay na kaibigan, sa hirap at ginhawa ay kasama.

49. Magtaka ka na kung hindi pa sya umuuwi bukas.

50. Le tabagisme est un facteur de risque majeur pour de nombreuses maladies, notamment les maladies cardiaques et le cancer.

Recent Searches

lot,1970skapintasangipinauutangnapadpadkaninakindergartenexperts,renaiaanunglinawdespuesmataascivilizationmejosemillastalagakabilangoverallmagdaplacefidelmediumpasanstreamingboardtumahantalanaantignag-pilotobumabagnagpatuloypandidirikapagnapakasipagnaghubadsimpelmagpapabunotmakidalonakaluhodnagkalapitbrancher,daramdaminyumuyukopahabolbaguiotulangbusyangwikanapatinginguhitahittuwidfireworksflyuminomcompletespreadhindiikinabubuhaypagkabiglakatuwaandesign,matamancnicoaddictioncompostelajoshslaveinfluentialpersistent,dulonapakamisteryosonaglalatangnapakagandangpresidentialkinamumuhiankaloobangmakahiramtatawagano-onlinemagkapatidnabighanipag-aaralininomlalabhanpantalonnatakotnahantadnakabaonpatongincrediblebibigyandissehimayinlalongellameetlorinagbasawhetherdoonpotentialandreculturaerhvervslivetumiinitnakakatandamakakakaensasakyannanunuksokommunikerernaririnigginamotbuwenasnearpatakbouwakdiyannagyayangbaryoparehasnatitiraeducationinfluencesanihinkinabukasanbakitgodtgraceviewsvisualjunjunrangemakapagsabinanahimiktahimikusuariotinawagxviisocialesmahuhulimagdaanctricasmatandangpebrerothanktasainalagaanpsssiconskumatoksoundtagakseniorgagkelanplasakapit-bahayhitiktillmapaibabawattractivemerryhojaslegislationbilugangamongtherapyburmanoousingipongheikaringmarasiganrebolusyonmagpasalamatlaki-lakinahihiyangsipagtataaswaternasagutannuevosmaghahabipinatidpopcornfuelmalakiairconsinunodallottedfiaexcusesnobchoicegisingsparkclases