Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "share"

1. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

2. Facebook Events feature allows users to create, share, and RSVP to events.

3. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

4. Instagram has become a platform for influencers and content creators to share their work and build a following.

5. Instagram is a popular social media platform that allows users to share photos and videos.

6. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

7. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

8. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

9. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

10. My best friend and I share the same birthday.

11. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

12. Retweeting is a feature that allows users to share others' tweets with their own followers.

13. The acquired assets will help us expand our market share.

14. The children eagerly lined up for their share of the birthday cake.

15. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

16. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

17. The website's social media buttons make it easy for users to share content on their social networks.

18. TikTok is a social media platform that allows users to create and share short-form videos.

19. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

20. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

21. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

22. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

23. Users can like, react, or share posts on Facebook to show their engagement and support.

24. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

25. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

Random Sentences

1. Claro, puedes contar conmigo para lo que necesites.

2. Pinakain ni Rose si Mrs. Marchant ng almusal.

3. Ang lahat ng taong napapadaan sa nasabing puno'y napapahinto dahil sa dami ng bungang nakasabit sa mga sanga.

4. Nang siya'y mapaibabaw, sinunud-ssunod niya: dagok, dagok, dagok.

5. Padalas nang padalas ang mga nawawala kaya't lumapit ang taong bayan sa kanilang makisig na hari upang humingi ng tulong.

6. Magaling maglaro ng chess si Joseph.

7. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

8. Inflation kann die Beziehungen zwischen den Ländern beeinträchtigen.

9. El powerbank se carga conectándolo a una fuente de energía, como un enchufe o una computadora.

10. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

11. Indonesia adalah negara dengan keragaman agama yang besar, termasuk Islam, Kristen, Hindu, Buddha, dan lain-lain.

12. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

13.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Sa ganang iyo, may pag-asa pa ba ang ating mundo sa kabila ng lumalalang polusyon?

16. Les écoles offrent une variété d'activités parascolaires telles que le sport, la musique et le théâtre.

17. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

18. Ano ho ang masasabi ninyo, Senador Santos?

19. En invierno, los días son más cortos y las noches son más largas.

20. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

21. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

22. Mahirap magsalita nang diretsahan, pero sana pwede ba kitang mahalin?

23. Kay sikip na ng daraanan ay patakbo ka pa kung lumabas!

24. Ang sugal ay naglalabas ng mga salarin na nagpapayaman sa pamamagitan ng pag-aabuso sa mga manlalaro.

25. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

26. La realidad es a menudo más compleja de lo que parece.

27. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

28. Kailangan magpakatotoo at humingi ng tulong kung hindi makakabayad ng utang sa tamang panahon.

29. Eksport af tøj og beklædningsgenstande fra Danmark er også stigende.

30. Sa loob ng simbahan, nararamdaman ko ang isang matiwasay na kapayapaan.

31. Nasa kanan ng bangko ang restawran.

32. La práctica hace al maestro.

33. The executive branch, represented by the President of the United States, is responsible for enforcing laws

34. Madalas akong nakakarinig ng kakaibang ingay sa labas ng bahay sa hatinggabi.

35. Huh? Anong wala pa? nagtatakang tanong ko.

36. Sweet foods are often associated with desserts, such as cakes and pastries.

37. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

38. Det danske økonomisystem er kendt for sin høje grad af velstand og velfærd

39. ¿Cual es tu pasatiempo?

40. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

41. Hindi siya bumibitiw.

42. Ang salarin ay nahuli matapos ang matagal na manhunt ng mga awtoridad.

43. Ang bituin ay napakaningning.

44. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

45. The dog barks at strangers.

46. Ang hindi pagtulog ng sapat na oras ay maaaring magdulot ng pagkapagod at kakulangan sa enerhiya sa araw-araw na buhay.

47. Masasaktan ka kung malalim na babasagin niya ang kaibuturan ng iyong pagkatao.

48. Me gusta preparar infusiones de hierbas para relajarme.

49. The roads are flooded because it's been raining cats and dogs for hours now.

50. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

Recent Searches

overviewpinalakingalinshareulingmethodssequestyrerpersistent,largetechnologicalinfinityevolvedrefconstitutioncontinuedcornerissuesleegminu-minutopagkabuhayaktibistapupuntahannakatapathampaslupacrushmakatatlonaibibigayteknologigawaingbobosinapitpagpanhikpagtataastumagalpagkabiglalumakassamang-paladnakabawibitawanthankstondonagwo-workbulakpasyapag-iyakpalakapriestpersonastunaynaglarootrasnanalotuyobrancher,artisto-onlinesalbahengnilaospaghangatumindigincredibletaksilakadpananakotgawalaganapsahodtransportillegalinstrumentalkutsaritangbayaninghinanapkunwapitumpongpsssbuslosinkmoodhatingfuellaborhonmakukulaydetectedhalikanpandidiritumabailogregularpicturesvibratenag-aalayikinabubuhaymedidajackyjuanitoharapanmatitigasopgaver,butasforskelkutodpondopangungutyapagpasensyahanposporonagbakasyonkatipunannaglipanangmeriendananghihinapagkakamalinagtungopagsumamoerhvervslivetnag-alalananangisdahan-dahankanlurankuwartogantingamuyinano-anotinatanongkulturhabitskinakainpinipilitvictoriaunanubos-lakasnawalaemocionesdumapaligaligpakaininkapalpinilitumibigpinabulaanangmadalipaggawakakayanangcampaignsngipingnatulogknightherramientasapotdesarrollarpangyayarikanansulinganmatchingcongresserrors,restaurantpaungoltagamaligayapakistanhapag-kainandayskumaripasdrayberbluetaun-taonhitapakilagaykasintahankumaenbopolsnararapatlipadltoiconicpunung-kahoyopoinantaybinginasagutanjoebotanteparoiniinomdiettaingadeterioratemaluwangadversepiecessubalitmariominutocarebusyangclasesnakapagngangalit