Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "share"

1. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

2. Facebook Events feature allows users to create, share, and RSVP to events.

3. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

4. Instagram has become a platform for influencers and content creators to share their work and build a following.

5. Instagram is a popular social media platform that allows users to share photos and videos.

6. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

7. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

8. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

9. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

10. My best friend and I share the same birthday.

11. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

12. Retweeting is a feature that allows users to share others' tweets with their own followers.

13. The acquired assets will help us expand our market share.

14. The children eagerly lined up for their share of the birthday cake.

15. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

16. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

17. The website's social media buttons make it easy for users to share content on their social networks.

18. TikTok is a social media platform that allows users to create and share short-form videos.

19. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

20. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

21. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

22. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

23. Users can like, react, or share posts on Facebook to show their engagement and support.

24. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

25. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

Random Sentences

1. Ang aming angkan ay mayroong mga natatanging tula at awitin.

2. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

3. Omelettes are a popular choice for those following a low-carb or high-protein diet.

4. Kalaro ni Pedro sa tennis si Jose.

5. Ang pagtangkilik ng musika o pagtugtog ng isang instrumento ay isang nakagagamot na karanasan na nagbibigay ng ligaya sa aking puso.

6. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

7. Isang araw, umuwing mainit ang ulo ng binatilyong apo dahil natalo sa sugal.

8. Nakapagsasakay ang dyipni ng 16 na pasahero.

9. Ang aming pamilya ay nagpapahalaga sa konsepto ng bayanihan at palaging handang tumulong sa kapwa.

10. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

11.

12. Kumikinig ang kanyang katawan.

13. Elektroniske apparater kan hjælpe med at overvåge og forbedre kvaliteten af ​​produkter.

14. The wedding rehearsal is a practice run for the wedding ceremony and reception.

15. Mas malaki ang huli, mas marami rin ang panindang maipapautang sa iyo ng ngingisi-ngising negosyante.

16. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

17. Ang laki ng wedding cake na ginawa ng kanyang ate.

18. Hinde mo pa nga pinapatapos yung sasabihin ko eh.

19. Ako ay bumili ng lapis sa tindahan

20. ¿Cuántos años tienes?

21. Kakain ako sa kapeterya mamayang tanghali.

22. The platform has also been criticized for promoting harmful content and contributing to online bullying.

23. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

24. Wie geht es Ihnen? - How are you?

25. Pinahiram ko ang aking cellphone kay Alex habang inaayos ang kanyang unit.

26. The sun is setting in the sky.

27. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

28. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

29. Climbing without proper equipment is incredibly risky and dangerous.

30. Stuffed Toys, Mini-Helicopter, Walkie-Talkie, Crush Gear, Remote Controlled Cars, at higit sa lahat, ang Beyblade.

31. Ok ka na ba? tumango si Athena, Mabuti naman..

32. May gamot ka ba para sa nagtatae?

33. At blive kvinde indebærer at tage ansvar for sit eget liv.

34. Nagsusulat ako ng liham upang ipahayag ang aking pasasalamat.

35. Ang magnanakaw ay napag-alamang anak ng isang kilalang kriminal sa lugar.

36. Hormonbehandling og kirurgi kan have forskellige risici og bivirkninger, og det er vigtigt for transkønnede personer at konsultere med kvalificerede sundhedspersonale.

37. Sa pagbabasa ng magandang libro, napapasaya at natutulog ako nang matiwasay sa gabi.

38. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

39. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

40. Sa kultura ng mga Igorot, mahalaga ang punong-kahoy dahil ito ang ginagamit sa kanilang mga ritwal.

41. Ang talambuhay ni Leandro Locsin ay nagpapakita ng kanyang husay at kontribusyon sa arkitektura ng Pilipinas.

42. But in most cases, TV watching is a passive thing.

43. Sino ang nagtitinda ng prutas?

44. Limitations can be viewed as opportunities for growth and personal development.

45. Ang mga pangarap natin ay nagtutulak sa atin upang magkaroon ng mga positibong pagbabago sa buhay.

46. Bless you.. tugon ko sa biglang pagbahing nya.

47. May I know your name for our records?

48. Nasa loob ako ng gusali.

49. Si Teacher Jena ay napakaganda.

50. Les travailleurs peuvent être contraints de travailler à distance en raison de la pandémie COVID-19.

Recent Searches

makaratingsharere-reviewmultopagsagotiiwasangandahanlaruancardiganoftejolibeemakikipaglarotagtuyotconclusion,tumalonjerrygumagamitmatutongkuwebanagdarasalmonetizingdyippagongpansamantalahighestprocesotsonggocitykaninamanamis-namismasarapalispaidkumukuhasabongpicturesmasokculturalkampeonkamandagsquatterkaklaseinischristmasissueslumayaslasonlegendarypinakatuktokcouldbroadcastscomienzanpumitaspagdatingdelegatedpatunayannagbiyayaumilingtaon-taonsumusunodnapatigilkatuwaaniparatingkayataun-taonnapatayomakatulogtaong-bayanmumuntinganongbroadcastydelsercomputersgranadasinasadyataonsinundomananakawmatustusanpataynakakatakotnaiinggitninongmaranasanhospitalflaviokriskanakaangateducatingpinatutunayanwalletkatagangapelyidopinilitculturasmapapabarnesgitanasbookstinulunganseriousctricasnalalabingtumugtogparaangmembersdadalawinkambingisasamakonsultasyonnagpabayadoffercultivatedseekinfectiousnaawakaharianbinilingmemorialboholswimmingkaramihansumusunomansanasmag-amatigasbopolstrueoverpaldacompositoressabihingmagdalamakikitulogtaingadumaantenreserbasyonnakasandigpagkapanalohuertonakaluhodpoongipinambilipinagawananlilisikfarmfollowedeskuwelayoutube,airportnakasakitstockstennisxixkasinggandaniyanpakilagaybelievednaiilagan1980unibersidadpackaginggumisingmalayahinawakanumiwaspinakamatapatnakalilipasniyongospelkinuhacenterhealthieribahagiayudareceptorkalahatinghistoriahinintaypiyanofeelmatikmanangkanantoniohimihiyawinulitbenefitsikinakagalitconsumemilatoothbrushkapatawaranistasyonhandaanpautangbentahanmeanattractivephilosophical