Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "share"

1. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

2. Facebook Events feature allows users to create, share, and RSVP to events.

3. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

4. Instagram has become a platform for influencers and content creators to share their work and build a following.

5. Instagram is a popular social media platform that allows users to share photos and videos.

6. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

7. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

8. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

9. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

10. My best friend and I share the same birthday.

11. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

12. Retweeting is a feature that allows users to share others' tweets with their own followers.

13. The acquired assets will help us expand our market share.

14. The children eagerly lined up for their share of the birthday cake.

15. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

16. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

17. The website's social media buttons make it easy for users to share content on their social networks.

18. TikTok is a social media platform that allows users to create and share short-form videos.

19. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

20. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

21. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

22. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

23. Users can like, react, or share posts on Facebook to show their engagement and support.

24. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

25. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

Random Sentences

1. Tumingin ito sa mga website ng mga bagay na pwedeng bilihin online.

2. Las hojas de las plantas de té deben secarse correctamente para obtener el mejor sabor.

3. Paano siya pumupunta sa klase?

4. Women have shown remarkable resilience and strength in the face of adversity and oppression.

5. Ang nagdudumaling helicopter ay masigla na naglilipad sa himpapawid.

6. Kasama ko ang aking mga magulang sa pamanhikan.

7. The wedding ceremony usually takes place in a church or other religious setting.

8. She spends hours scrolling through TikTok, watching funny videos and dance routines.

9. Saya sayang dengan keindahan alam di Indonesia. (I love the natural beauty of Indonesia.)

10. Dahil dito nag-away-away ang mga mababangis na hayop at mga ibon.

11. Paano mo pinalambot ang giniling na karne?

12. When life gives you lemons, make lemonade.

13. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

14. Sa aking paglalakad, natatanaw ko ang magandang tanawin ng bukid na pambihirang nagpapalaya sa aking isipan.

15. Sa mga nakalipas na taon, yumabong ang mga organisasyon na tumutulong sa mga nangangailangan.

16. I've been driving on this road for an hour, and so far so good.

17. Larry Bird was a versatile forward and one of the best shooters in NBA history.

18. Pinagtatalunan nila kung sino ang mas may karapatang manirahan sa malago at mayamang kagubatan.

19. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

20. Ako po si Maico. nakangiting sabi niya.

21. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

22. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

23. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

24. Lumuhod siya sa harap ng altar at tulala sa loob ng ilang minuto.

25. Napatigil ako sa pagtawa ng seryoso nyang sinabi yun, Eh?

26. Hindi umabot sa deadline ang kanyang report, samakatuwid, binawasan ang kanyang grado.

27. Ang tulang ito ay may petsang 11 Hulyo 1973.

28. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

29. Baka makatatlo pa ang kanyang nanay ngayon!

30. La labradora de mi sobrina es muy amigable y siempre quiere jugar con otros perros.

31. Ang kalayaan ay hindi dapat magresulta sa pagpapahirap sa ibang tao.

32. Omelettes can be seasoned with salt, pepper, and other spices according to taste.

33. Los héroes pueden ser aquellos que defienden los derechos humanos y luchan contra la opresión.

34. Nogle helte går frivilligt ind i farlige situationer for at redde andre.

35. Magkano ang tiket papuntang Calamba?

36. Cada nacimiento trae consigo la promesa de un futuro lleno de posibilidades.

37. Mahilig siya sa pagluluto, datapwat madalas ay hindi niya nasusunod ang tamang recipe.

38. Ang mga ideya ni Rizal tungkol sa pagkakapantay-pantay, edukasyon, at pagkakaisa ay patuloy na nagbibigay-inspirasyon sa mga Pilipino.

39. Lumingon ako para harapin si Kenji.

40. Magandang Gabi!

41. Las hojas de los cactus son muy resistentes y difíciles de cortar.

42. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

43. Sorry, I didn't catch your name. May I know it again?

44. Hinde ko dala yung cellphone ni Kenji eh.

45. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

46. Ang paggamit ng droga ay hindi lamang nakakapinsala sa kalusugan, kundi pati na rin sa kabuuang pagkatao.

47. Los motores de búsqueda nos permiten encontrar información específica en línea.

48. Wala naman. I think she likes you. Obvious naman di ba?

49. Ok. Alam mo, isa pa yung excited na magka-apo eh.

50. Nabigla siya nang biglang napadungaw sa kanya ang isang ibon.

Recent Searches

sharejunjunpagsidlangodtnakatigilumarawagricultorestiyakpeepbarnesnaantigsummerdisensyosanggolipihitmahabolutilizansingsingquelalakaddumilatputingflashtumingalatingbalikathumalakhaksusunodpasensyapinoyculturasnanamanpabulongoffertumatawagdepartmentkutodnagtatakbonalalabingcoatpaghabamaglalakadnakapaligidnanlilisikyeahsasagutinmagagamitnangangarallibrocomputeresequeidea:branchadditionallyclocke-booksnagsisigawleytetravelerpinag-usapannangapatdanipagbilihuluataquesnanlalamigunahinpagkasabihinilapebrerokakaantay1954hahahanagdadasalrollbigotepwedengincreasedechaveisinalangneedsanavidenskabpoongcultivarkinakitaanstocksarkilachavitreorganizingaywansiguradosumasambakinauupuanghitamagpakaramibatocuentanbateryasittingnaiinissuelopaki-drawingkirotdrinkeventostinapaypinilitnananalohealthierpisngisusinakabawimeaningbukodnilalangsamfundmasasabicontestjudicialreaksiyonmaibigaynagtutulungangamefonosnanaisintenawardipatuloytiningnangreenhillslalabastignananaybook:redesunibersidadpaskomay-bahaytaong-bayanmariloueksport,trentamagbaliktaglagasgodpartblueipinauutangbagsaknakauwibayanipinagbigyannamanganaroomsambitlumuwasubonapadpadplaceiligtasturnbatang-batapabalingatlinawballpulubiisinusuotdaramdaminfacepagkagisingnagmamadaliabundantesnacover,puwedepagpapatubonapilitangabspanaythanknagsuotnagtungokasalisinagotkamustahimselfupuanaidtumamacertaindatapwatanidelepaliparinbinulongmakilingneartekstofte