Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "hojas"

1. Cuando las plantas tienen al menos dos hojas, trasplántalas al lugar definitivo

2. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

3. El té verde se elabora con las hojas de una planta de hierbas llamada Camellia sinensis.

4. En invierno, los árboles pierden sus hojas y se vuelven caducos.

5. Hay muchas hojas en el jardín después de la tormenta.

6. La brisa movía las hojas de los árboles en el parque.

7. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

8. Las hojas de eucalipto se utilizan a menudo para aliviar la congestión nasal.

9. Las hojas de la hierbabuena se pueden usar para hacer té o mojitos.

10. Las hojas de las plantas de té deben secarse correctamente para obtener el mejor sabor.

11. Las hojas de lechuga son una buena opción para una ensalada fresca.

12. Las hojas de los árboles cambian de color en otoño.

13. Las hojas de los árboles proporcionan sombra y protección contra el sol.

14. Las hojas de los cactus son muy resistentes y difíciles de cortar.

15. Las hojas de mi cuaderno están llenas de garabatos y notas.

16. Las hojas de mi planta de menta huelen muy bien.

17. Las hojas de mi planta de tomate se ven amarillentas y enfermas.

18. Las hojas de otoño son muy bonitas en la ciudad.

19. Las hojas de palma se usan a menudo para hacer sombreros y cestas.

20. Las hojas de palmera pueden ser muy grandes y pesadas.

21. Las hojas de papel se pueden reciclar para hacer papel nuevo.

22. Las hojas de té son muy saludables y contienen antioxidantes.

23. Las hojas del libro están todas marcadas con notas adhesivas.

24. Las plantas perennes viven durante varios años, renovando sus hojas y flores de forma periódica.

25. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

26. Los árboles pueden perder sus hojas en invierno, creando un aspecto desnudo y frío.

27. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

28. Puedes saber que el maíz está maduro cuando las hojas inferiores comienzan a secarse y las espigas están duras al tacto

Random Sentences

1. Binentahan ni Aling Maria ng prutas si Katie.

2. He forgot his wallet at home and therefore couldn't buy lunch.

3. Elektronik kan være en kilde til underholdning og sjov.

4. Los padres experimentan una mezcla de emociones durante el nacimiento de su hijo.

5. Nag-aabang ang mga kabataan sa kalsada habang nagiigib ng balde-balde ng tubig para sa kanilang water balloon fight.

6. Cancer can impact not only the individual but also their families and caregivers.

7. May mga pagkakataon na naisip niyang may kailangan siyang bilhin sa grocery store, pero pagdating niya roon, bigla niyang nalimutan kung ano iyon.

8. Many people start their day with a cup of coffee to help them wake up and feel more alert.

9. He has learned a new language.

10. It can be helpful to create an outline or a mind map to organize your thoughts

11. Beth ang pangalan ng matalik kong kaibigan.

12. Mura lang pala ang bili nya sa kanyang damit.

13. Pakibigay sa tindera ang tamang bayad para hindi siya malugi.

14. Peace na tayo ha? nakangiting sabi niya saken.

15. Las hojas de los árboles cambian de color en otoño.

16. Ano ang pinapakinggan mo sa radyo?

17. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

18. Hindi ako kumportable sa kanilang desisyon dahil mayroon akong mga katanungan kaya ako ay tumututol.

19. Ang tagtuyot ay nagdulot ng krisis sa agrikultura sa buong rehiyon.

20. Cryptocurrency is often subject to hacking and cyber attacks.

21. Pneumonia is a serious infection that affects the lungs.

22. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

23. Mas magaling siya kaysa sa kanya.

24. Unrealistic expectations can contribute to feelings of frustration and disappointment.

25. Nakakapagod pala bumaba ng bundok.

26. Saan siya nagpa-photocopy ng report?

27. Wag kang magtatanim ng sama ng loob sa kapwa.

28. Politics in America refers to the political system and processes that take place in the United States of America

29. El parto puede ser natural o por cesárea, dependiendo de las circunstancias y la salud de la madre y el bebé.

30. J'ai acheté un nouveau sac à main aujourd'hui.

31. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

32. Nagsisilbi siya bilang public servant upang matugunan ang pangangailangan ng kanyang nasasakupan.

33. Membuka tabir untuk umum.

34. The cat was sick, and therefore we had to take it to the vet.

35. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

36. Ang mga dahon ng bayabas ay nagagamit din sa medisina.

37. Ang Chinese New Year ay isa sa pinakamahalagang pagdiriwang sa kultura ng Tsina.

38. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

39. Paano ho ako pupunta sa Palma Hall?

40. We have been married for ten years.

41. Ang talambuhay ni Emilio Jacinto ay nagpapakita ng kanyang kabataan at ang kanyang kontribusyon sa rebolusyon.

42. Ang digmaan ay isang matinding kaguluhan sa lipunan at pangkalahatang kapaligiran.

43. The DNA evidence led to the arrest of the culprit in the murder case.

44. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

45. Kings may wield absolute or constitutional power depending on their country's system of government.

46. Beauty. si Maico sabay yakap sa akin mula sa likod.

47. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

48. Huwag kang lalayo nang palayo sa amin para hindi ka mawala.

49. Kumain ako sa kapeterya kaninang tanghali.

50. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

Similar Words

hojas,

Recent Searches

hojaskuwintastelefonerchunpumatolnuhfakesyncpaki-bukasnagdarasalandrebreakibonbiggestkinikilalangadvancehomeworkknowledgetrycycleautomaticlumilipadmataaasinfluencesmilyongmurangmahalaganagpapaypaybilispaligidbodaoposelleskuwelahanmadulasmusmosnobelaisusuotpaghanga1950snagsusulatumiibigpinagwagihangtumatawadHabangpasswordsalahotdogsagotbusloulongpangungutyacountlessnagtatrabahooxygenresponsiblekaparusahanrelysaranggolacosechasbrightsantokapataganminahannagmukabarriersmahiwagangdumilatyourkahongde-dekorasyonmatabangumakbaymaubostresipagbilinyemedikalsumalivedisinamamaghilamosditosangavehiclesisinuottradisyonpakikipagtagpoadvertising,boyfriendhihigitkurbatadatapwatskillssettingvitamintinataluntonmadamikagandahanlever,throatkinapanayamnakapagngangalitkwartonakakatulongpisngitoothbrushnabalitaancitizenswaiternakabaonmatandangpalasyokasuutannamatayraisemaibigaydumarayomaiskunenovellessundalohetokaaya-ayangnapakabilisbubongasthmatanimtamaprosesohahatolbilihinkadaratingfranciscotodayspeedhawakorganizenag-iimbitayuntulunganpalayokabibistoremakikiligokumalmaevenbinawiaregladopadrepagsayadcardmakapagsabimaglabalookedunattendedsaktansabogdidinggarbansosgraphicnangangaralumangatmakessamukayongso-calledmanahimikprimernagreplystrategiessubalitinitgrinsparehinanakitvankaninangupuanunosnakatawagsicabakurankapaintumalimbahatagalogincreaseslubosiginawadhundredopdeltpakinabangansiraputinaisubonapakatalinobilibmatatalinonakapapasong