Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "millions"

1. Amazon has a vast customer base, with millions of customers worldwide.

2. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

3. Coffee is a popular beverage consumed by millions of people worldwide.

4. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

5. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

7. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

8. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

9. The company acquired assets worth millions of dollars last year.

10. The song went viral on TikTok, with millions of users creating their own videos to it.

11. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. Walang anuman saad ng mayor.

2. Coffee shops and cafes have become popular gathering places for people to socialize and work.

3. Kapag hindi ka tumigil sa paggamit ng droga, magdudulot ito ng mas malalang kahihinatnan sa hinaharap.

4. Alin ang telepono ng kaibigan mo?

5. Ang mga punong-kahoy ay kadalasang tinatanim bilang mga pampaganda sa mga pampublikong lugar tulad ng parke o plaza.

6. Eine gute Gewissensentscheidung zu treffen, erfordert oft Mut und Entschlossenheit.

7. Ayoko magtrabaho sa bahay sapagkat naiinis ako sa buhok na ito.

8. Pagkatapos ng magandang ani, ang aming hardin ay hitik sa sariwang gulay at prutas.

9. Sabay sabay na nagtanghalian ang mga estudyante sa canteen.

10. Ako ay nagtatanim ng mga succulent plants sa aking munting terrarium.

11. Håbet om at opnå noget kan motivere os til at tage skridt for at nå vores mål.

12. Mathematics has many practical applications, such as in finance, engineering, and computer science.

13. Saan pumunta si Trina sa Abril?

14. Más vale tarde que nunca. - Better late than never.

15. La labradora de mi vecina siempre ladra cuando alguien pasa por la calle.

16. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

17. Napakabuti nyang kaibigan.

18. Samantala sa bahay, nagluluto siya ng paboritong putahe ng kanyang asawa.

19. Ang sugal ay isang mapanlinlang na paraan ng pag-asang maaaring magdulot ng pagkabigo at pagkasira sa buhay.

20. Ako'y napatingin sa dalagang nababalot ng hiwaga

21. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

22. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

23. Ang obra maestra ay gawa ng mga tao na mayrroong malawak na imahinasyon

24. Bakit lumilipad ang manananggal?

25. Les personnes âgées peuvent être sujettes à des chutes et d'autres accidents.

26. Bantulot niyang binawi ang balde, nakatingin pa rin kay Ogor.

27. Ha?! Ano ba namang tanong yan! Wala noh!

28. Tumakbo siya para sa pagka-pangulo noong 1935 ngunit natalo kay Manuel Quezon.

29. Pakilagay mo nga ang bulaklak sa mesa.

30. Naghihirap na ang mga tao.

31. Matagal akong nag stay sa library.

32. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

33. La novela de Gabriel García Márquez es un ejemplo sublime del realismo mágico.

34. La santé des femmes est souvent différente de celle des hommes et nécessite une attention particulière.

35. Ano ang mga apelyido ng mga lola mo?

36. Ano ang gustong sukatin ni Merlinda?

37. Yan ang totoo.

38. My daughter made me a homemade card that said "happy birthday, Mom!"

39. Microscopes are commonly used in scientific research, medicine, and education.

40. Halos nakalimutan na ng mag-asawa ang nangyari sa diwata.

41. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

42. Actions speak louder than words.

43. Dadalo si Trina sa workshop sa Oktubre

44. Kumain siya at umalis sa bahay.

45. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

46. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

47. Bilang paglilinaw, ang pagpupulong ay gaganapin sa online platform, hindi sa opisina.

48. Sa paglipas ng panahon, natutunan niyang tanggapin ang pag-iisa.

49. La prevención del uso de drogas es fundamental para reducir los índices de adicción.

50. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

Recent Searches

spendingmillionskaringrightnaggingitinuringdosnaroonpinalakingemphasisellensutilhelpfulinterpretingmagta-taxinananaghilibawatdahan-dahankusinamakapilingilingipinalitprocessstyrereditknowtechnologicalbehindsamatechnologiesnakikini-kinitangipingmakapangyarihankapatawaranmalapitmarurumimamamanhikankambingdadalosellnumbersumusulatnasaumalisremembereddumaannakasakaypumuntacitizenmaisclientscaremaglabakelangannamnahulitekadigitalitemspinabayaanboksinglumalakinahuhumalingkahongmundoibat-ibangginangkumirotvidenskabentransportmidlermagazinesbarung-barongkahusayannamuhaymanunulatnavigationmumuntingnahahalinhantransportnabiawangbarcelonanagbantaypatakbongtinanggapmanahimikexpeditedmagsasakacampaignsmatangkadpagkainiskasamaangnatandaanbinabaratlansanganipinamilisalbahevidenskabnailigtaspagsasayamedya-agwaidiomatotookinukuyomumagangsayawankuripotsagabaltumawagpaskongumiimikamericapangkathigantehuwebeshulihanmagsabinamulatpagputiiniinomgagamitasiaticbilibidstrategiesretirargumigisingsisikathanapbuhayreguleringrestaurantkayabanganipapahingakaraniwangmagbigayanbeginningssarisaringdiagnosticsumimangothumalakhakdiferentessakalingpinamalagiinimbitanatatanawmakakawawamakikitamahahawapasaheropakaininmangahasmatipunotomorrowatensyonkanayangutilizanpagsahodtagpiangkaharianmerlindainihandagasolinamagtipidpakisabiorkidyasorganizemalayangmitigatehappenedsugatanglenguajemanonoodcocktailnabigyanmagselosdrowingmagalangsasakyanperwisyoika-50kongresopatpatentreincitamentersandalinglittlepangilbosesremainnapakolalongandreastoresumubohojasituturofilmsanumanwalngnararapatbilinpalagi