Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "millions"

1. Amazon has a vast customer base, with millions of customers worldwide.

2. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

3. Coffee is a popular beverage consumed by millions of people worldwide.

4. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

5. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

7. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

8. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

9. The company acquired assets worth millions of dollars last year.

10. The song went viral on TikTok, with millions of users creating their own videos to it.

11. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. Waring nag-aalinlangan siyang sagutin ang tanong ng guro.

2. Les enfants ont des besoins de santé particuliers qui doivent être pris en compte.

3. Las escuelas pueden ofrecer programas de intercambio estudiantil para estudiantes internacionales.

4. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

5. Ang Ibong Adarna ay nagpakita ng magagandang aral tungkol sa katapangan, pagkakaisa, at pagpapatawad.

6. Ang pagsusuri ng wastong hudyat ay mahalaga sa interaksiyon ng tao at sa pag-unawa ng iba't ibang anyo ng komunikasyon.

7. I like how the website has a blog section where users can read about various topics.

8. Inialay ni Hidilyn Diaz ang kanyang tagumpay sa Diyos at sa kanyang pamilya.

9. Naging tradisyon na sa kanilang baryo ang pagdiriwang ng kaarawan ng kanilang santo.

10. Ano na nga ho ang pamagat ng palabas ninyo?

11. Las escuelas también tienen la responsabilidad de asegurar un ambiente seguro para los estudiantes.

12. Bakit lumilipad ang manananggal?

13. Some couples choose to have a destination wedding in a different country or location.

14. Nang buksan ng mga tao ang ilang bunga ng punong-kahoy, kanilang nakitang ang balat ay makapal at ang buto ay malaki, ngunit ang laman nama'y matamis

15. Nang malapit na siya, nagtatakbo ang dalaga at nawalang parang bula.

16. Amazon is an American multinational technology company.

17. Gusting-gusto ng kanyang magtatapos na anak ang minatamis na garbansos.

18. Congress is divided into two chambers: the Senate and the House of Representatives

19. Mahal na mahal kita. Ikaw lang. pabulong kong sabi.

20. Napuyat na ako kakaantay sa yo.

21. Pour maintenir sa motivation, il est important d'avoir des objectifs clairs et réalisables.

22. I am absolutely committed to making a positive change in my life.

23. S-sorry. mahinang sabi ni Mica.

24. Namnamin ang bawat minuto kasama ang iyong pamilya.

25. Baka makatatlo pa ang kanyang nanay ngayon!

26. The nature of work has evolved over time, with advances in technology and changes in the economy.

27. It is important to identify the cause of frustration in order to find a solution and alleviate the negative feelings associated with it.

28. Mag-usap tayo sa WhatsApp o Line.

29. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

30. Si Maria ay malakas ang boses, bagkus ang kanyang kapatid ay tahimik.

31. Hindi ako makapaniwala sa nakikita ko.

32. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

33. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

34. I have a craving for a piece of cake with a cup of coffee.

35. Naisip niya na mas maganda kung nag-iisa siya sa bukid.

36. Nakapag-celebrate kami ng aming anniversary ng asawa ko kaya masayang-masaya ako ngayon.

37. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

38. Gaano ka kadalas pumunta sa doktor?

39. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

40. Hinanap ko ang pulotgata sa bukid upang magkaroon ng panghimagas.

41. Asul ang kulay ng mata ng anak ko.

42. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

43. Ang marahas na paggamit ng lakas ay labag sa etika at pagkamamamayan.

44. ¿Te gusta la comida picante o prefieres algo más suave?

45. Hinugot niya ang susi sa kanyang bulsa at binuksan ang pinto.

46. Una mala conciencia puede llevarnos a tomar malas decisiones.

47. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

48. The decision to release the product early was a risky but ultimately successful strategy.

49. Wala siyang dalang payong, samakatuwid, nabasa siya ng ulan.

50. Inakalang magugustuhan ng lahat ang ideya niya, pero tinanggihan ito.

Recent Searches

introducemillionsadverselydaysreducedperlarailbirdsanongpaggawamerchandiserobinhoodinstitucionesmagdilimkakayananincrediblepamimilhingdyosacurtainsbalik-tanawhigaanpossiblelikasextradingginanupatayphilosophytumubongbulategumuhitcrucialpagtatanghalnag-iisiplaganapisipanlearningmestmatandangsamuyumuyukopersonspoliticalginawarannatagalandumapahumingafencingmasasayakumaenhierbas300problemadosfollowedkoreablendtagilirantambayanentrybusyangstorytinigilnag-iisapaglakipisaralandevetoareae-commerce,umilinghalalanrightnag-uwireadersinterests,electronicallottedbibigstarmasdanhelpfulinagawcontinuecompanysumugodnag-emailsimbahanhanapbuhaynagbiyayautak-biyatextnaiilangkabuntisanstarskuryenteskillsgagamitmalakiedsapumiliimageshatinggabipuedennagbalikbritishsyangmakilingtiposspaghettieveningpaglipashomeworkrememberedprosperlangkaykakutisbahay-bahaymustspendingipinikitagapocawordsmarahasawadelkaugnayantryghedhalamannakapagngangalitbarcelonagagawinyou,hinahaplosmanahimikvehiclespinsannagawangnabalitaankabuhayanumanoliligawantransportationkagalakandiyosipaghugaskatipunansiembralapitanpatrickiikutantinaposelektronikkausapinmaaliwalasnakabawienergyjackzpatongmasterpatuyohindeasukalsmallkakayanangpinagmamasdanpinagtulakannapakalakasnag-eehersisyogonggulofaceyukoheregiftgiitubos-lakasedit:draft,pinaggagagawanohmilyonggamegirlsandoksilbingasimpag-iyaksalaiphonephonepublicationrobinbiyahemaligohamonhayophabitscardigan