Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "millions"

1. Amazon has a vast customer base, with millions of customers worldwide.

2. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

3. Coffee is a popular beverage consumed by millions of people worldwide.

4. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

5. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

7. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

8. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

9. The company acquired assets worth millions of dollars last year.

10. The song went viral on TikTok, with millions of users creating their own videos to it.

11. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. Hindi maganda na palaging may agam-agam sa buhay, dahil ito ay maaaring magdulot ng stress at anxiety.

2. Pagkatapos ng ulan, naging maaliwalas ang kapaligiran.

3. The patient had a history of pneumonia and needed to be monitored closely.

4. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

5. Ang mga natatanging kontribusyon ng mga siyentipiko sa kanilang larangan ay dapat na itinuring at ipinagmamalaki.

6. A lot of noise from the construction site disturbed our peace and quiet.

7. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

8. Pinikit niya ang mata upang namnamin ang sarap ng tsokolate.

9. Saya sayang dengan keindahan alam di Indonesia. (I love the natural beauty of Indonesia.)

10. Det er vigtigt for samfundet at arbejde på at inkludere og respektere transkønnede personers rettigheder og behov.

11. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

12. The policeman directed the flow of traffic during the parade.

13. Na-promote ako sa higher position sa aking company kaya masayang-masaya ako ngayon.

14. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

15. Have you tried the new coffee shop?

16. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

17. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

18. Nasa kanan ng restawran ang sinehan.

19. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

20. Sa panahon ng tagtuyot, ang mga ilog at sapa ay halos natutuyo na.

21. Some of her most famous songs include "No Tears Left to Cry," "Thank U, Next," "7 Rings," and "Positions."

22. The photographer captured a series of images depicting the changing seasons.

23. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

24. You're stronger than this, pull yourself together and fight through the tough times.

25. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

26. Medarbejdere kan skifte karriere når som helst i deres liv.

27. Hindi dapat natin hayaang mayroong paglapastangan sa mga pangalan ng mga namayapa.

28. Los héroes nos inspiran a ser mejores y nos muestran el poder de la bondad y el sacrificio.

29. Omelettes are a popular choice for those following a low-carb or high-protein diet.

30. Ultimately, a wife is a partner and equal in a marital relationship, contributing to the success and happiness of both spouses.

31. Nagkakasayahan sila sa isang panig ng bilangguan

32. Ofte bliver helte hyldet efter deres død.

33. Sa ilalim ng lumang kahoy, natagpuan namin ang malamig na lilim na nagbibigay ng kapahingahan sa aming paglalakbay.

34. Bawat pamilya ay may magarang tarangkahan sa kanilang mga tahanan.

35. Si Rizal ay kilala bilang isang makata, manunulat, pintor, doktor, at lider sa paglaban sa kolonyalismong Espanyol.

36. Siya ay hindi marunong magtimpi kaya't laging nagmamalabis sa pagpapahayag ng kanyang saloobin.

37. Ang mga pag-uusig at pang-aapi ay mga halimbawa ng malubhang paglapastangan sa karapatan ng tao.

38. She carefully layered the cake with alternating flavors of chocolate and vanilla.

39. Dahil lumamang naman sa pagkakataong iyon ang mga mababangis na hayop, sa kanila lumapit si Paniki.

40. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

41. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

42. Hindi pa rin makapagsalita si Mang Kandoy.

43. Namnamin ang bawat minuto kasama ang iyong pamilya.

44. Busy pa ako sa pag-aaral.

45. Hindi namin mahanap ang tarangkahan ng bahay mo kaya't nag-text kami sa iyo.

46.

47. Dumating ang mga atleta sa entablado nang limahan.

48. Musk has been named one of the most influential people in the world by TIME magazine.

49. The cake is still warm from the oven.

50. Robert Downey Jr. gained worldwide recognition for his portrayal of Iron Man in the Marvel Cinematic Universe.

Recent Searches

millionsadverselypangalananoutpostanak-mahirapkarangalanpaboritonggamitkapeteryanaglalatangkapwasharmainemagkanonararamdamannabahalaayanhimigniyonganag-aabanginalalayanmaglarolangmakakibobutterflyparatingnogensindenag-iyakanemphasisbokpagkakatayobabyayonabundanteibinibigaypabulongmunamagalangmaibigaynakikini-kinitaqualitypumuntakababayanmakalaglag-pantynamaneditorhalikansummitaccessracialmasyadongkatibayangniyonnakaraanagricultoresnakapangasawainuulamlimitedusedamparogeologi,subject,pinagalitanfotospinagkaloobanshopeetaxibaranggaytrainsinterestsnatalongconstitutioniwinasiwaspinaghatidannapaluhanapatakbopagpapautangcableginaharapanyoutubepinagbigyannagkitagasmenipagmalaakinatigilankumbinsihinbilanginmeaninghalikapatongbawatlivesagilaisinaboyeventoslastnangampanyaiiklinagyayangkasakitmayamannatanongiskosaidnagpapasasaabigaelkuliglighawlamatandangmakipagtagisanhalakhaknagagandahaniyamotturntuyoinfluencesnapakapasensyamagpahababisigdalawininompaglalayagpublishing,gubatpalaynakaakyatpagbabagong-anyomadalingtig-bebeinteemocionalbringingmagulayawsaragagnakiniginspireheregivermakalipastagtuyotnakakagalanagtatakboschoolsnilolokomagkasamaikinamataylongfremtidigedurisinipangtrafficnaibibigaynakapuntaubonagwaginag-aalalanghinanapnawawalanilutoibinentagraphicmanamis-namislargernumerosaspakelamsoundiikottandanglalabamakapagsabitog,kabuhayanelectpaksasellinglalamunanatensyongvoteslcdmagsaingpasinghalnagbasaaidshiftkumakalansingdingginsiglosulyapfeedbackeffectsharapmahinogworryevolucionadomakakakaenkangkongdialledguro