Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "millions"

1. Amazon has a vast customer base, with millions of customers worldwide.

2. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

3. Coffee is a popular beverage consumed by millions of people worldwide.

4. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

5. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

6. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

7. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

8. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

9. The company acquired assets worth millions of dollars last year.

10. The song went viral on TikTok, with millions of users creating their own videos to it.

11. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. Tulad ng dapat asahan, bumuhos na ang malakas na ulan.

2. Using the special pronoun Kita

3. Nagsusulat ako ng aking journal tuwing gabi.

4. Ok ka lang? tanong niya bigla.

5.

6. Busog pa ako, kakatapos ko lang mag merienda.

7. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

8. Nakita kita sa isang magasin.

9. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

10. Recycling and reducing waste are important ways to protect the environment and conserve resources.

11. Emphasis can help clarify and reinforce the meaning of a message.

12. They do not skip their breakfast.

13. Madulas ang magnanakaw, ngunit nahuli rin siya ng mga naglalakad na sibilyan.

14. Kailangan ng mas malawak at mas matatag na suporta sa sektor ng anak-pawis upang malutas ang mga isyu ng kahirapan.

15. Sabi ko bumangon ka jan! Hoy!

16. Gusto kong mag-order ng pagkain.

17. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

18. Ahhh...wala! Bakit ba, nagdadasal ako noh!

19. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

20. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

21. Eh ayoko nga eh, sundae lang talaga gusto ko.

22. Tumingin ako sa direksyon kung saan sya nagtatrabaho...

23. Pnilit niyang supilin ang hangaring makasilong.

24. Anong wala! pasinghal na sabi ni Aling Marta

25. Endvidere er Danmark også kendt for sin høje grad af offentlig velfærd

26. El nacimiento de un bebé es motivo de alegría y celebración.

27. Pagkalipas ng dalawang linggo ay nakatanggap si Nicolas ng sulat galing kay Haring Bernardo.

28. Ah ganun ba sabi ko habang naka tingin sa cellphone ko.

29. Ang pakikinig sa malumanay na himig ng mga instrumento ay nagpapalapit sa akin sa isang matiwasay na mundo.

30. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

31. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

32. Hindi siya naging maramot nang magbigay ng kanyang oras para tumulong sa proyekto.

33. Les écoles offrent des programmes pour aider les étudiants à se préparer aux examens d'entrée à l'université.

34. Nabahala si Aling Rosa.

35. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

36. Laking pagkamangha ni Aling Rosa ng makita ang anyo ng bunga nito.

37. Påskelørdag er dagen, hvor Jesus lå i graven, og der afholdes ofte en stille og reflekterende gudstjeneste.

38. Sumasakit na naman ang aking ngipin.

39. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

40. Drømme kan inspirere os til at tage risici og prøve nye ting.

41. He blew out the candles on his birthday cake and made a wish.

42. The patient's family history of high blood pressure increased his risk of developing the condition.

43. At malaman ng maaga ang wasto sa kamalian.

44. Nagpaabot ako ng bulaklak sa kanyang bahay upang ipakita ang aking pagmamahal sa nililigawan ko.

45. Ang pag-inom ng tsaa tuwing umaga ay isa nang ritwal na nagbibigay ng enerhiya sa kanya.

46. Le livre que j'ai lu était très intéressant.

47. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

48. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

49. Ang kanyang malalim na pangarap ay animo'y imposibleng maabot ngunit patuloy pa rin siyang nagsusumikap.

50. Tesla was founded by Elon Musk, JB Straubel, Martin Eberhard, Marc Tarpenning, and Ian Wright.

Recent Searches

teachmillionsditothenpakpaknaritodeathyousparkadditionadverselyrosefeedbackimagingdinalamagbubungacomputereyoungplayschangemabutingstudentskartonrolledbeintewriteputingtabaaffectcuandotopicandroidshiftworkinggraduallyquicklycontrolledpalanagpanggaphousesisikatunonegativecareeryoutube,emphasistumingalangunitkumidlatdisensyonagbibiroadicionaleswindowmusicaldaandiagnosticngingisi-ngisingnaninirahannakapagreklamonagsisipag-uwianbusinessesnaglakadtinatawaginirapaninvestingsasagutinmakidalosalamangkeropagtiisankikitanagkasunogmanatilinareklamohalu-haloyakapinbestfriendiintayinpagmamanehotungawpamilihannakauwipandidiriyumuyukopamumunointensidadnagagamitenviarnami-missnapapansinsasakyannasasalinannaghihirapo-onlinemagawaisinusuotlumindolbinuksanhistorygospelnatabunannavigationtotoorenacentistatumapospinanalunantsupermagpakaramibefolkningennaghubadmakalinghistoriananamannakauslingkailanmanhabitssuriinsangapanibagongbaguiotatlongkainankasiluboscalidadmabigyannatakottirangipinansasahogbanklipatmakulitituturofriendgaanogabidiseaseskasuutanbilanggojagiyakakayananginiibigiskedyulkananbumabagmeansbinilhanlookedejecutanindividualstsssmaistorbobuntispasasalamathumalobecomingsantopopcornmaluwangcapitalpalapittuwingeducativascasaubolintacineconectadosrhythmlatehumanosmaaringitonglawsreaderscriticswordkablanlutodecisions4thareadahontabassumangtextoadventateimaginationcoachingcadenanatingupworkventaboxthoughtsguiltybababinabafurthernaroon