Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "mens"

1. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

2. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

3. Mens nogle mennesker kan tjene penge ved at gamble, er det en risikabel investering og kan ikke betragtes som en pålidelig indkomstkilde.

4. Mens nogle mennesker nyder gambling som en hobby eller en form for underholdning, kan det også føre til afhængighed og økonomiske problemer.

5. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

Random Sentences

1. Ang pagkakaroon ng malalakas na ingay mula sa kapitbahay ay binulabog ang kapayapaan ng tahanan.

2. Maaring ibigay ng guro ang libro sa akin.

3. Habang naglalakad siya, nakita ko siyang tulala sa kanyang cellphone.

4. People can also borrow money through loans, credit cards, and other forms of debt.

5. Bukas ay pumunta daw po kayo sa school sabi ng aking teacher.

6. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

7. Omelettes are a popular choice for those following a low-carb or high-protein diet.

8. Binili ni Rita ang damit sa tindahan.

9. Takot, nanginginig ang kanyang mga daliri.

10. Lapat na lapat sa kanya ang kamisetang iyon noong bagong bili ngunit ngayo'y maluwag na.

11. Libre si Clara sa Sabado ng hapon.

12. Una de las obras más conocidas de Leonardo da Vinci es La Mona Lisa.

13. Maraming paniki sa kweba.

14. Si Andres ay pinagpalaluan ng kanyang mga kaibigan dahil sa kanyang tapang at determinasyon.

15. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

16. Les programmes d'études sont élaborés pour fournir une éducation complète.

17. The meeting was cancelled, and therefore he had the afternoon off.

18. Magtatapos ako ng aking thesis sa buwan na ito, datapwat kailangan kong maglaan ng mas maraming oras para dito.

19. Les maladies infectieuses telles que le VIH/SIDA, la tuberculose et la grippe peuvent être prévenues grâce à une bonne hygiène et des vaccinations.

20.

21. Det er vigtigt at tage hensyn til ens egne begrænsninger og sundhedstilstand, når man vælger en form for motion.

22. Puwede paki-ulit ang sinabi mo?

23. Wag kang magtatanim ng sama ng loob sa kapwa.

24. Forgiveness allows us to let go of the pain and move forward with our lives.

25. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

26. They have planted a vegetable garden.

27. I admire the perseverance of those who overcome adversity.

28. En casa de herrero, cuchillo de palo.

29. Las escuelas también tienen la responsabilidad de asegurar un ambiente seguro para los estudiantes.

30. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

31. A couple of friends are coming over for dinner tonight.

32. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

33. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

34. Sa kaibuturan ng kanyang pagkatao, mahal niya ang pamilya niya.

35. Lee's influence on the martial arts world is undeniable

36. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

37. Isang araw, napagod na ang mga diwata sa away ng mga mababangis na hayop at mga ibon.

38. Alam mo naman na mabait si Athena, di ba?

39. The reviews aren't always reliable, so take them with a grain of salt.

40. Elektronikken i en flyvemaskine kan hjælpe med at overvåge flyvningen og opretholde sikkerhed.

41. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

42. Nanlilimos ang magandang babae ng makakain.

43. Isinalang ni Pinang ang lugaw ngunit napabayaan dahil sa kalalaro.

44. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

45. My boyfriend took me out to dinner for my birthday.

46. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

47. Ang panaghoy ng bayan ay naging inspirasyon upang magkaisa para sa pagbabago.

48. In conclusion, the telephone is one of the most important inventions in human history

49. La paciencia es necesaria para tomar decisiones importantes.

50. Ang bayanihan ay nagpapakita ng kahalagahan ng pagtutulungan at pagkakaisa sa pagharap sa mga suliranin.

Similar Words

mensahemensajes

Recent Searches

gustongbankescuelastusongberetimensmemorialtagaloghugismataraymangingibigcharismaticdisyembremalumbaytinitindaexpeditedonlinesigeagadbasahinmalambingnatandaanfameklasrumgoshmatikmanuulitkadalagahangnagulatdettehearpanaypeacemassesasulshopeeuso00amkartonhayaanputingcertainfacestoplightincreasesimpactedsimplengentrysiraforskeltumawagunattendedsystems-diesel-runnapuyatpaninigasadgangmedikalprocessartistspagsuboktungkodsantoskills,isinuotiyamottshirteveningnakapikitmagtanimhistorianatigilanitinulosnalalabiproudiconicsignyourself,automatiskpetsangadverseprimerbatojerrytheykapilingstoplegendsnasarapankongresopagsagotasignaturanaglarosaan-saankamandagnaiisipmateryalesengkantadangpahiramsundalogumawamakukulaypagamutantaga-hiroshimayumabongbutikiasiaanimokaibiganjacewidespreadvideofireworkssoonsellpakainsumabogestablishmasdanhydelroomshowsnahulicinenapabalikwassumarapbutiscalegitanasgovernmenttechnologicalelectedfourmultopointplatformsinilingareanerissarelievedcorrectingresourcescouldpepemagasawangnagkakasyapagkamanghamakakasahodnangangahoymumuranakatuwaangressourcernebangladeshnakikilalangnagngangalangagricultoreswalkie-talkiemakapangyarihangsportsvisualstrategiesfue1929ingatanteleviewingmadamibinawitradedalawapalapitfreevalleygraphicnakasuotnapatingalascottishgawingnapakamotkinauupuankanmahiwagangnapakasipagmakasilongkumikinigkarunungannasasabihangulathila-agawantatawagtiniradorpagkuwanagkasunogmonsignornanditoisamakatapatpinatiramatesaiyakplagasnena