Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "nagtapos"

1. Ang kabanata ay nagtapos sa isang maigting na eksena o cliffhanger, na nagtulak sa mga mambabasa na magpatuloy sa pagbasa.

2. Kailan nagtapos ng kolehiyo si Peter?

3. Kailan siya nagtapos ng high school

4. Nagtapos siya ng kolehiyo noong 1982.

5. Nagtapos siya sa kolehiyo noong 1990.

6. Nagtapos sya sa unibersidad ng Pilipinas.

7. Saan nagtapos ng kolehiyo si Peter?

8. Saan siya nagtapos ng kolehiyo?

Random Sentences

1. Les travailleurs peuvent changer de carrière à tout moment de leur vie.

2.

3. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

4. Nanghiram ako ng bicycle para sa isang bike race.

5. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

6. Narinig ko ang lagaslas ng tubig mula sa shower.

7. Dadalaw ako kay Lola Sela bukas.

8. Los niños son propensos a sufrir de tos debido a infecciones respiratorias comunes, como el resfriado común y la gripe.

9. A couple of books on the shelf caught my eye.

10. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

11. Ang mahal ng bili nya sa cellphone.

12. Nang buksan ng mga tao ang ilang bunga ng punong-kahoy, kanilang nakitang ang balat ay makapal at ang buto ay malaki, ngunit ang laman nama'y matamis

13. She does not procrastinate her work.

14. She is playing with her pet dog.

15. Ano ang gustong sukatin ni Elena?

16. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

17. Nagsasama-sama ang mga Pinoy tuwing Pasko para magdiwang.

18. Pakibigay na lang sa kanya ang sukli para hindi na siya bumalik pa.

19. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

20. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

21. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

22. Ang carbon dioxide ay ina-absorve ng mga puno.

23. Some people have a sweet tooth and prefer sweet flavors over others.

24. Gusto ko na talaga mamasyal sa Singapore.

25. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

26. But all this was done through sound only.

27. Masakit ang ulo ng pasyente.

28. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

29. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

30. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

31. La película que produjo el estudio fue un gran éxito internacional.

32. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

33. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

34. Durante las vacaciones, me gusta relajarme en la playa.

35. Les échanges commerciaux peuvent avoir un impact sur les taux de change.

36. Overcoming frustration requires patience, persistence, and a willingness to adapt and learn from mistakes.

37. Magandang umaga po, Ginang Cruz.

38. Ignorar nuestra conciencia puede llevar a sentimientos de arrepentimiento y remordimiento.

39. Bagkus sa pag-ulan, ang panahon ay mainit at maalinsangan.

40. Ipaghugas mo siya ng mga Maghugas ka ng mga

41. Gawa ang palda sa bansang Hapon.

42. Påskeæg er en traditionel gave i påsken og er ofte fyldt med slik eller små gaver.

43. Pakibigay ng lakas ng loob ang bawat isa upang magpatuloy sa buhay.

44. At sa sobrang gulat di ko napansin.

45. Transkønnede børn og unge skal have adgang til støtte og ressourcer til at udforske deres kønsidentitet i en tryg og støttende miljø.

46. Hinde ko alam kung bakit.

47. Huwag kayo maingay sa library!

48. Lumabas lang saglit si Genna dahil may tumawag sa kanya.

49. Pupunta kami sa Cebu sa Sabado.

50. Ofte bliver helte hyldet efter deres død.

Recent Searches

nagtapospagsahodnakapikitlilipadisubobanalisinamatsinainspirationtalinopaliparinmatandangnuevosmariebulongbumangonbarangaysisipainnatitirapakainintataascurtainsganyanahhhhaddictioncarriesmatayoghangintsuperkirotforskelmusicianssmilebaryosellingelectorallivesbagayoutlinekarangalaniskedyulcnicomaingattrajeinalagaanlistahaniikligoodeveningmapahamakfamecassandraiyanumaagoshugishinoganywhereairconeffektivpeaceresignationpinatidbagyobilaoiniinombiglasnasuccessmayroonsumabogeffortscryptocurrency:katabinglegendsnahulimedievalminutotoothbrushreservesbabesnami-missbugtongscientist10thmalinismajorcardcallernagbungasoreunderholderbaulpumikitkasiyahanhinamonmapakalifriespedepaastevetekstnathanpooksinongfatsaringeksenaochandowaysbitawanconectanvasquestargetborndidgracehomeworkiosbahayparanghumingasecarseimprovedrelievedkitaggressioncontinuednagtagisanmagbubungabringingboycomputereconditioningtiyaputingcomplexsalapinotebookcomunicarsehelloremoteberkeleypagpapatubokayang-kayangpananghalianrabedrowingpagpapautangpinagalitanmagbabagsikkuwartonagingkapintasangpagbigyantumatakboprincipalespaumanhinpinauwimasaktanundeniablehatinggabibutoinintaypagkatimbeslilysusulitdaramdaminsemillascapitaldagat-dagatanthenreservationsumalasumakitopportunitiesnanalocuentanmapaikotrichhimselfshapinguripag-indakmanghikayatalignsmessagemediummakikipagbabagpaki-translatetinikpinigilannapalitangnanunuribuwisvaccinesnagbibiroperfectlibreendeligmakikipag-dueto