Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "programming"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

3. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

Random Sentences

1. ¿Quieres algo de comer?

2. Kapag umuulan, hindi puwedeng maglaba ng mga damit sa labas.

3. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

4. Les personnes âgées peuvent souffrir de diverses maladies liées à l'âge, telles que l'arthrite, la démence, le diabète, etc.

5. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

6. Los powerbanks suelen tener puertos USB que permiten conectar diferentes tipos de dispositivos.

7. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

8. Ang lider ng samahan ay pinagpalaluan ng mga miyembro dahil sa kanyang integridad.

9. Gusto kong tumakbo at maglaro sa parke.

10. Las hierbas frescas añaden un toque de color y sabor a las ensaladas.

11. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

12. Mi vecino tiene una labradora dorada que siempre corre a saludarme.

13. Habang naglalaba ang kanyang ina ay walang tigil namang naglalaro si Juanito.

14. La salsa de chile es una de mis favoritas, me gusta el sabor picante.

15. Nang malamang hindi ako makakapunta sa pangarap kong bakasyon, naglabas ako ng malalim na himutok.

16. Sa kaibuturan ng kanyang damdamin, mahal niya ang kanyang mga kaibigan.

17. Nag-aalala ako sa mga pinagdadaanan ng aking nililigawan at lagi kong inuunawa ang kanyang mga kailangan.

18. Naka color green ako na damit tapos naka shades.

19. The stuntman performed a risky jump from one building to another.

20. Nag-aabang ang mga kabataan sa kalsada habang nagiigib ng balde-balde ng tubig para sa kanilang water balloon fight.

21. Ang lakas mo kumain para kang buwaya.

22. Ang hirap pigilan ng inis kapag may nagawa sa atin ng hindi maganda.

23. Umuwi na tayo satin.. naramdaman ko ang pagtango niya

24. Bukas ay mamamanhikan na kami sa inyo.

25. A portion of the company's profits is allocated for charitable activities every year.

26. Huwag po, maawa po kayo sa akin

27. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

28. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

29. At ginawaran ng isang matamis na halik ang labi ng naguguluhang si Mariang Maganda.

30. Cutting corners on food safety regulations can put people's health at risk.

31. My best friend and I share the same birthday.

32. Ibinigay niya ang kanyang pagmamahal at pag-aalaga upang masiguro ang kaginhawahan ng kanyang pamilya.

33. Gawin mo ang nararapat.

34. On dit souvent que l'argent ne fait pas le bonheur, mais il y contribue grandement.

35. Kuwartong pandalawahan, hindi ho ba?

36. She does not skip her exercise routine.

37. Sa bawat hampas ng alon, tila naririnig ko ang panaghoy ng mga nawawala sa dagat.

38. Einstein was offered the presidency of Israel in 1952, but declined the offer.

39. Isang malaking pagkakamali lang yun...

40. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

41. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

42. Det er vigtigt at tage hensyn til ens egne begrænsninger og sundhedstilstand, når man vælger en form for motion.

43. Gambling kan have negative konsekvenser for en persons mentale og fysiske sundhed, samt deres relationer og økonomiske situation.

44. Aku merindukanmu, sayang. (I miss you, dear.)

45. Les prêts sont une forme courante de financement pour les projets importants.

46. La brisa movía las hojas de los árboles en el parque.

47. Pinaluto ko ang adobo sa nanay ko.

48. Kailangan ko ng bumalik sa aming kaharian dahil kung hindi ay hindi na tayo muling magkikita pa.

49. Para sa kaniya, mas masarap magbasa kapag nag-iisa.

50. Si Hidilyn Diaz ay isang inspirasyon para sa maraming Pilipino, lalo na sa mga kabataan.

Similar Words

programming,

Recent Searches

oftenformatprogrammingcomputeresimplengmultostudiedbitawanplannaiinggittominternetgamotpaulaeskwelahandagat-dagatannabahalamaalikabokinfinityshininghenrynaglutofeedbackmalasutlaownkawaljingjingmednyangsakimgayunmannamnamumulotbarrocofianapakatongiwinasiwaseksamenbrancher,nagstagepinag-aralanatinpara-paranggrowthkaysarapmagpaliwanagmarmaingtanyagpaakyatbarongtransparentkuwartabinabatibulatemarahasnatapostabanag-iisangarbularyoduguanhubad-baronasulyapangaslumahokmatalimnabigkascurtainsmakausapmaongdunmaskimarahilhariamparohumansignificantclimbednagsilabasanlargerglobalnamanrosastime,usaintroduceferrersumpunginpagsayadvirksomhedernananaginippinakamatabangnagpapasasakinikitakomunikasyonpagtutolpropensomakikitanaglahowalkie-talkienamumulaklaknagkakatipun-tiponlasonguugud-ugodpangyayarinagpabayadnagliwanagpamahalaanculturalnagsisigawkagipitanmagalangbeautyairportpinagbigyanhitabayawakelevatorkumalaspakakasalanpersonastennisgospelamericakarapatangdepartmentnagwalismagbabalanatitiyaklagnattig-bebeintenapilimagazinesmaskinerlalargaparusahanpigilanguerrerojeepneytandangbintanafriendkapagbinabarathanapinnaglabanagpasanfollowingmatutulognobodynakabaonlabinsiyamipatuloylagaslasasahanmoneylakadpalayocommercialmayabongnabiglaobservation,maidbisikletakaragatandiaper2001misteryotawapaggawaisuboplagasejecutankahusayanpinalayasenerobooksmaayosnariyansocialehverganangoutlineutilizarjenakaugnayankulangmatabangbinanggamaestromahirapcivilizationdalawanoopaghingihitiktrensinumangeasier