Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "congress"

1. Congress are elected every two years in a process known as a midterm election

2. Congress is divided into two chambers: the Senate and the House of Representatives

3. Congress, is responsible for making laws

Random Sentences

1. Bago pa man napigilan ng bata ang babae ay naisubo na nito ang puting laman ng bunga.

2. Magaling na ang sugat ko sa ulo.

3. It's raining cats and dogs

4. Oscilloscopes can capture and store waveforms for further analysis and comparison.

5. Kapansin-pansin ang dami ng mga insekto na naglipana sa gabi.

6. Hindi maganda na palaging may agam-agam sa buhay, dahil ito ay maaaring magdulot ng stress at anxiety.

7. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

8. Masyado ka naman nagpapaniwala kay Andrew!

9. Fødslen er en af ​​de mest transformative oplevelser i livet.

10. Bukas na lang ako pupunta sa bangko.

11. Paano po ninyo gustong magbayad?

12. Ang kabanata ay nagbigay ng mahahalagang detalye tungkol sa nakaraan ng pangunahing tauhan.

13. Sa Manila Hotel ka titigil, hindi ba?

14. Ang pag-asa ay nagbibigay ng mga solusyon sa mga problema at hamon sa buhay na hindi magagawan ng paraan.

15. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

16. El invierno se caracteriza por temperaturas frías y, a menudo, por nevadas.

17. Las escuelas son lugares de aprendizaje para estudiantes de todas las edades.

18. Natutuwa ako kapag nakakakita ako ng isang halamanang mayabong sa mga pampublikong lugar.

19. Kahit paano'y may alaala pa rin siya sa atin.

20. Umiling ako. Hindi naman po. nakangiti ko pang sagot.

21. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

22. She decorated the cake with colorful sprinkles and frosting.

23. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

24. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

25. Nagplano akong maglakad-lakad sa park, datapwat bigla akong tinawagan ng aking kaibigan para magkape.

26. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

27. La moda de usar ropa estrafalaria está llamando la atención de los jóvenes.

28. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

29. Quien siembra vientos, recoge tempestades.

30. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

31. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

32. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

33. Estoy muy agradecido por tu amistad.

34. Algunos fines de semana voy al campo a hacer senderismo, mi pasatiempo favorito.

35. Nariyan sa kahon ang kamiseta mo.

36. Si Pedro ang tatay ko at siya ang nanay ko.

37. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

38. Je suis en train de manger une pomme.

39. Nagkalat ang mga adik sa kanto.

40. Ang mga bata ay nagtatanim ng mga buto upang makita ang proseso ng paglaki ng mga halaman.

41. Saglit lang lang naging kami. Sabi niya sa akin..

42. Mahusay gumawa ng bahay ang kanyang tatay.

43. Fra biler til fly til tog, teknologi har gjort det muligt for os at bevæge os hurtigere og mere effektivt end nogensinde før

44. Marami ang botante sa aming lugar.

45. Kung hindi siya maramot, baka mas marami ang natulungan niya.

46. He admires the honesty and integrity of his colleagues.

47. La realidad es que a veces no podemos controlar lo que sucede.

48. We have been painting the room for hours.

49. Musk has been involved in various controversies over his comments on social and political issues.

50. The pretty lady in the park was surrounded by admirers.

Recent Searches

congressbabesmedievalbarnesilogpulissenateisipkadarating1940langpalagaymensahetalamapalampaskarnabalnaroonfascinatingferrertargetstudentdaigdigbigoperateenchantedeveningtekstvedstonehamprofessionaltaun-taoneasiergreenwarishiftprocesswhiletypessalapirememberkasingelectthreenotebookgenerationssteerbeforebaldedoonpinilingfurtherpigingkanawatchnaghihinagpisbalangkinalalagyannagpuntamagazineswakaspamahalaaniniindamayabongkisapmatagapkaparehasinabiparkemgauuwinapakamisteryosodalawabingominamasdanbakuranampliasundaenaabotestarkumalmamagmangungudngodkagatolpumulotmatindingpa-dayagonalpinapalogalakakingconclusion,i-collectsahigextremistbillfertilizermasasamang-loobculturessiglodulotugattalinoninaisfilmsmadadalapiyanopusopalibhasatwo-partychefmagpa-ospitalworkshopmagbabalasikkerhedsnet,alinnanamannagkasakitakokamandagmagagawainsektongminamahalpumapaligidpupuntahankalayuanna-suwaytinangkaestudyantenagpabayadbusyangmulighednyaabalasinipangeithercaresilbingdoktorprimertoothbrushritoumagakainnandayatabingsaranggolatabasagam-agamlikasmagbagong-anyogratificante,naupotiniradorkikitanegosyantenagkwentotumahimikkadalagahangmagkakailanakapagsabinangampanyanakakainnahintakutannakatindigmatagpuanguitarranapipilitanmahuhusayumiinomkasintahannakuhaprovidedcalidadmatatagandrewdistanciamagsasakaasignaturapagsagotlondonmagpapigilmagtagovillagetumiranangangakosuzettenaaksidentepabulongnasaankaramihansagutinisinuottinataluntonkontinentengopisinasagabaldisensyokagubatanbulalaspaanotig-bebeinte