Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "broadcast"

1. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

2. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

3. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

Random Sentences

1. The United States has a diverse landscape, with mountains, forests, deserts, and coastal regions.

2. Hindi sadyang nasaktan siya nang malaman niyang iniwan siya ng kanyang kasintahan.

3. The police were searching for the culprit behind the rash of robberies in the area.

4. Naramdaman ko ang kanyang malalim na halinghing sa telepono.

5. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

6. Protecting the environment involves balancing the needs of people and the planet.

7. Inakalang wala nang pag-asa, pero may dumating na tulong.

8. Sa muling pagkikita!

9. Bigla niyang mininimize yung window

10. Binigyan ng pangalan ng Apolinario Mabini ang isang bayan sa Batangas.

11. Ang kanyang galit ay nagbabaga sa ilalim ng malamig niyang mga ngiti.

12. She joined a charitable club that focuses on helping the elderly.

13. This has led to increased trade and commerce, as well as greater mobility for individuals

14. Kumalas ako sa pagkakayakap niya sa akin.

15. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

16. Get your act together

17. Nandito ako sa entrance ng hotel.

18. Nilaos sila ng bata at dahil dito, mas lalong yumabang ang bata.

19. Aba'y lintek na babaeng ito! Ang langis mo! Paano na ako magugustuhan ni Pedro nyan! ani ni Ipong sabay hawi ng buhok.

20. Naglabanan sila upang makita kung sino ang tatagal at mananaig.

21. Sumigaw ng malakas si Perla "Paro! Paro!", marami ang nakarinig at tinulungan siya ngunit walang Amparo silang nakita.

22. Ipanlinis ninyo ng sahig ang walis.

23. Después de la tormenta, el cielo se vuelve más oscuro y las nubes se alejan.

24. Les travailleurs peuvent travailler dans une variété de domaines tels que la finance, la technologie, l'éducation, etc.

25. The patient had a history of pneumonia and needed to be monitored closely.

26. Bukas na bukas din ay kakain tayo sa labas.

27. Drømme og håb kan drive os fremad i livet.

28. Les hôpitaux peuvent être des environnements stériles pour prévenir la propagation des infections.

29. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

30. Sino-sino ang mga nagsibili ng mga libro?

31. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

32. He's always the first one in the office because he believes in the early bird gets the worm.

33. This can be a great way to leverage your skills and turn your passion into a full-time income

34. Kung anong puno, siya ang bunga.

35. Sang-ayon ako na kailangan nating magtulungan upang malutas ang mga suliranin ng ating lipunan.

36. Les personnes âgées peuvent avoir besoin d'une aide financière pour subvenir à leurs besoins.

37. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

38. Nalaki ang mga mata ni Mica sa sinabi ni Maico.

39. The athlete's hefty frame made them well-suited for their position on the team.

40. Kumikinig ang kanyang ulo at nangangalit ang kanyang ngipin.

41. Ang galing nyang mag bake ng cake!

42. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

43. Sa mga tunog ng kundiman, nabibigyang-buhay ang mga kuwentong umiikot sa pag-ibig at pagdurusa.

44. Las labradoras son conocidas por su energía y su amor por el agua.

45. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

46. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

47. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

48. Ang ibon ay mabilis na lumipad palayo matapos itong pakawalan mula sa hawla.

49. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

50. Our relationship is going strong, and so far so good.

Similar Words

Broadcastingbroadcasts

Recent Searches

broadcastlabasmag-usapsafebloggers,commander-in-chiefaccederzoowinsnapapalibutandibarelevantjustkeeptungkolbowlkiniligikinagagalakmaisusuotdumarayobulalasmaliitmakapagsalitahubadhiyakayasharingmakilingguidanceuugod-ugodchartsdrivernapapansinmakasarilingfacemaskmulti-billiongenerabagenerationerpeppyquarantinelupangnamangtambayanngayosersakitkurakotpublicationnagwalismakitapracticesaddingstringinteligenteskumarimotmonitorpusonganak-mahirappang-aasarmailaphiligbutilnaglalaroturonharapinnagbigayanputingnagitlalapispagtitindapulubiitimpinigilanmeetingayawtusongkaninoyelotuklashiramin,dolyarchoimahiwagaisa-isasignificanttsismosatataykalikasannagdiretsoactivitynakikilalangibabawpinabililucytuwaaggressiondiagnosessaradonagpabotkamandagpinggatatloyourself,nagsasagotbinanggamakapag-uwimag-babaitnakalimutansultancovidtelevisionshutculturaldioxidegatheringpoorermighteasybinibigayjuanitocrucialipapaputolmahinapotentialwalang-tiyakeffektivtnaglipanaeksperimenteringb-bakitdibisyonandyfeartinderanagawanagtatanimikatlongpedengtabihanpumuslitmallnasarapanpaligsahancassandralibreyeheypinagbubuksantiyangongstockskeepingestatekayangkotsengmagkasinggandaalas-diyesmarypagkabatadoble-karamay-arimatatalimpangkaraniwanpatipagdukwangbuwantinulungannag-uumigtingnakasakayigigiitpagsigawtowardspatiencemaipapamanabinigaypandemyamukanapangitipinaghandaangumalinglinggo-linggonakarinigmakapagpahingatanawinkawalanisipantig-bebentenuevosnapakabagalhanap-buhaypagsisisibigkishimihiyawhitsurangumingisibihirafestivalesmalungkotnatitiyakmarunongkokakbaryo